Recombinant Mesorhizobium sp. ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpB; Meso_0696; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Chelativorans sp. (strain BNC1)
Target Names
atpB
Target Protein Sequence
MATDPIHQFQISKLIPIEIGGLDFSFTNSSLFMVATVAAAGAFLYLTTSSRGLVPSRMQS VSEMSYEFVASMLRDAAGSHGMRFFPFVFSLFMFVLVANLLGLFPYFFTVTSHIVVTFAL ALLVIGTVLVYGFWKHGFGFLKLFVPEGVPGVLLPLVVLIEVISFLSRPISLSVRLFANM LAGHITLKVFAGFVTSLGALGVAGAAGAVLPLAMTVALTGLELLVAFLQAYVFAVLTCMY LNDALHPGH
Uniprot No.

Target Background

Function

Function: A key component of the proton channel, directly involved in proton translocation across the membrane.

Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (atpB) in Mesorhizobium sp.?

ATP synthase subunit a (atpB) in Mesorhizobium sp. is a critical component of the F-ATP synthase complex, specifically part of the membrane-embedded F0 complex that facilitates proton translocation. In Mesorhizobium sp. (strain BNC1), the atpB gene (locus name: Meso_0696) encodes a protein with UniProt accession Q11KH9. The protein functions within the membrane sector of ATP synthase, contributing to the establishment of proton gradients necessary for ATP synthesis. The full-length protein sequence comprises 249 amino acids and forms a helix-loop-helix structure that is integral to the function of the ATP synthase complex .

How does the structure of Mesorhizobium sp. atpB differ from other bacterial species?

While the core function of ATP synthase is conserved across species, structural variations exist in different bacterial lineages. Unlike mycobacterial ATP synthase subunit α, which contains a unique 36-amino acid C-terminal extension that regulates ATP hydrolysis activity, Mesorhizobium sp. atpB demonstrates the standard structural features common to most bacterial F-ATP synthases. The F0 domain typically contains subunit a (atpB) and a ring structure composed of multiple c subunits that form the proton channel. In prokaryotic F-ATP synthases, each 120° rotation is divided into 40° and 80° substeps during the catalytic cycle, coordinating ATP synthesis or hydrolysis . These structural characteristics influence experimental approaches when working with recombinant atpB proteins.

What techniques are recommended for optimal storage and handling of recombinant Mesorhizobium sp. atpB?

For optimal stability and activity of recombinant Mesorhizobium sp. atpB, store the protein at -20°C for regular use or at -80°C for extended storage. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability. Repeated freeze-thaw cycles significantly diminish protein activity, so preparing small working aliquots and storing them at 4°C for up to one week is recommended for active experimentation periods. When handling the protein, maintain sterile conditions and briefly centrifuge tubes before opening to collect any material adhering to the cap or sides . For experiments requiring longer shelf-life, lyophilized formats may be preferable, with reconstitution in sterile water immediately before use.

What expression systems are most effective for producing recombinant Mesorhizobium sp. atpB?

The selection of an expression system for recombinant Mesorhizobium sp. atpB depends on experimental requirements for protein yield, post-translational modifications, and downstream applications. Based on current research approaches with similar membrane proteins, E. coli expression systems (particularly BL21(DE3) strains) offer efficient expression for basic structural studies, while eukaryotic expression systems may be beneficial when studying interactions with eukaryotic ATP synthase components.

When expressing atpB in heterologous systems, several methodological considerations should be addressed:

  • Codon optimization based on the host organism

  • Addition of appropriate tags for purification and detection (typically determined during the production process)

  • Temperature modulation during induction (often lowered to 18-20°C)

  • Use of specialized membrane protein expression strains

For functional studies, co-expression with other ATP synthase subunits may be necessary, as demonstrated in similar research with chloroplast atpB where interaction with other complex components was essential for proper activity .

What purification strategies yield the highest purity and activity for recombinant Mesorhizobium sp. atpB?

Purifying membrane proteins like atpB requires specialized approaches to maintain native conformation and activity. A multi-stage purification protocol is typically recommended:

  • Solubilization using mild detergents (DDM or LMNG)

  • Initial capture using immobilized metal affinity chromatography (IMAC) if the protein contains a histidine tag

  • Secondary purification via ion exchange chromatography

  • Final polishing using size exclusion chromatography

For functional studies of ATP synthase complexes, digitonin or amphipol A8-35 have shown superior results in maintaining complex integrity compared to conventional detergents. Yields can be optimized by adjusting solubilization conditions (detergent:protein ratio, temperature, and ionic strength) based on preliminary small-scale experiments. The presence of glycerol (10-20%) in all buffers helps maintain stability during the purification process.

When assessing purity and activity, a combination of SDS-PAGE analysis and ATP hydrolysis activity assays provides comprehensive quality control metrics before proceeding to more advanced experiments .

How can researchers effectively verify the identity and structural integrity of recombinant Mesorhizobium sp. atpB?

Verification of recombinant Mesorhizobium sp. atpB identity and structural integrity requires a multi-modal analytical approach:

Verification MethodApplicationKey Parameters
Mass SpectrometryProtein identificationPeptide coverage >80%
Circular DichroismSecondary structure analysisα-helical content assessment
Size Exclusion ChromatographyOligomeric state verificationMonodisperse elution profile
Western BlottingTag and identity confirmationSpecific antibody detection
Activity AssaysFunctional verificationATP hydrolysis or proton pumping

For Western blot analysis, antibodies against conserved regions of ATP synthase subunits like those used for the beta subunit can be adapted with appropriate controls. Recommended dilutions of 1:1000 to 1:5000 are typically effective for detection, with expected apparent molecular weight around 27 kDa for atpB . For complex formation studies, blue native PAGE can provide valuable information about the integration of recombinant atpB into larger ATP synthase assemblies.

How can recombinant Mesorhizobium sp. atpB be utilized in protein-protein interaction studies?

Recombinant Mesorhizobium sp. atpB serves as an excellent model for studying protein-protein interactions within membrane protein complexes. Several methodological approaches can be employed:

  • Co-immunoprecipitation with epitope tags: The recombinant protein can be engineered with epitope tags (HA, FLAG, etc.) to facilitate pulldown of interaction partners. This approach was successfully used in studies with HA-tagged AtpB in photosynthetic research, clearly distinguishing the recombinant protein from endogenous counterparts .

  • Crosslinking mass spectrometry: Chemical crosslinkers with different spacer lengths can capture transient and stable interactions between atpB and other ATP synthase subunits, with subsequent MS/MS analysis identifying interaction interfaces.

  • Surface Plasmon Resonance: Immobilizing purified atpB on sensor chips allows quantitative measurement of binding kinetics with potential partner proteins.

  • Förster Resonance Energy Transfer (FRET): Fluorescently labeled atpB can be used to monitor real-time interactions and conformational changes during ATP synthesis/hydrolysis cycles.

When designing these experiments, it's crucial to maintain the native membrane environment or use appropriate membrane mimetics (nanodiscs, liposomes) to preserve physiologically relevant interactions.

What approaches are effective for studying the role of atpB in ATP synthase assembly and function?

Understanding atpB's role in ATP synthase assembly and function requires techniques that can monitor both the assembly process and the resulting enzymatic activities:

  • In vitro reconstitution systems: Purified components can be systematically combined to determine minimal requirements for complex formation and activity, with atpB variants helping to identify critical regions for assembly.

  • Site-directed mutagenesis: Strategic mutations in conserved residues can reveal functional domains involved in proton translocation or subunit interactions. The rotational movement of the c-ring forces central subunits to rotate, causing conformational changes in nucleotide-binding subunits that lead to ATP synthesis .

  • Single-molecule techniques: FRET-based approaches and high-speed atomic force microscopy can visualize conformational dynamics during the catalytic cycle, revealing how atpB contributes to complex function.

  • Proteoliposome assays: Reconstituted proteoliposomes containing ATP synthase complexes with wild-type or mutant atpB can measure proton pumping activity through pH-sensitive fluorescent dyes.

These approaches have revealed that even partial incorporation of recombinant ATP synthase components can restore activity, as demonstrated in studies where nuclear-expressed AtpB accumulated at only ~5% of wild-type levels yet significantly restored photosynthetic parameters .

How does the function of Mesorhizobium sp. atpB compare with homologs from other prokaryotic and eukaryotic systems?

Comparative functional analysis of ATP synthase components across species provides valuable insights into evolutionary adaptations and potential therapeutic targets. Several key differences have been observed:

  • Regulatory mechanisms: Unlike mycobacterial ATP synthases, which possess a unique 36-amino acid C-terminal extension that suppresses ATP hydrolysis, Mesorhizobium sp. atpB lacks this regulatory element. This structural difference correlates with differential ATP hydrolysis rates and energy conservation strategies adapted to each organism's ecological niche .

  • Proton/ion specificity: While most F-ATP synthases utilize proton gradients, some bacterial species have adapted to use sodium ions. Comparing the channel-forming residues in atpB across species reveals the molecular basis for this ion specificity.

  • Inhibitor sensitivity: Differential sensitivity to known ATP synthase inhibitors across species can be mapped to variations in the atpB sequence, providing structure-function relationships valuable for antimicrobial development.

  • Integration with metabolic networks: The regulation of ATP synthase activity through post-translational modifications of atpB differs between photosynthetic organisms like cyanobacteria and heterotrophic bacteria like Mesorhizobium, reflecting adaptation to different energy acquisition strategies.

When conducting comparative studies, it's essential to consider the physiological context of each organism, as the ATP synthase complex is integrated into diverse energy-generating pathways across species .

What are common challenges in expressing and purifying functional recombinant Mesorhizobium sp. atpB?

Researchers frequently encounter several challenges when working with recombinant Mesorhizobium sp. atpB:

  • Inclusion body formation: As a hydrophobic membrane protein, atpB often aggregates during heterologous expression. This can be mitigated by:

    • Lowering induction temperature to 16-18°C

    • Using specialized E. coli strains designed for membrane proteins (C41, C43)

    • Co-expression with chaperones (GroEL/GroES)

    • Adding fusion partners that enhance solubility (MBP, SUMO)

  • Detergent selection: The choice of detergent critically affects protein stability and function. Systematic screening of detergents is recommended, starting with mild options like DDM and LMNG before testing harsher detergents if necessary.

  • Maintaining native conformation: ATP synthase subunits often require interaction with partner proteins for proper folding. Co-expression strategies or reconstitution approaches that incorporate multiple subunits may yield more functional protein.

  • Activity assessment: Unlike soluble enzymes, membrane-embedded ATP synthase components require specialized assays to verify activity. Proteoliposome-based assays that reconstitute the protein in artificial membranes provide the most physiologically relevant activity measurements.

Each of these challenges requires systematic optimization, and conditions that work for other membrane proteins or even ATP synthase components from different species may not be directly transferable to Mesorhizobium sp. atpB .

How can researchers overcome difficulties in reconstituting functional ATP synthase complexes with recombinant atpB?

Reconstitution of functional ATP synthase complexes represents one of the most challenging aspects of studying recombinant atpB. Successful approaches include:

  • Stepwise assembly protocols: Rather than attempting to assemble the entire complex simultaneously, researchers can build the complex incrementally, verifying intermediate assemblies before proceeding to the next step.

  • Lipid composition optimization: The lipid environment significantly influences ATP synthase assembly and function. Screening different lipid compositions (varying head groups, acyl chain lengths, and degrees of saturation) can identify optimal conditions for reconstitution.

  • Native isolation of partner subunits: When studying recombinant atpB, using native ATP synthase subcomplexes isolated from Mesorhizobium sp. as partners can facilitate proper integration of the recombinant subunit.

  • Nanodiscs and other membrane mimetics: Traditional liposomes can be challenging to work with due to size heterogeneity and limited stability. Newer membrane mimetics like nanodiscs provide more controlled environments for reconstitution studies.

  • Heterologous expression systems: When individual components prove difficult to reconstitute, expressing multiple subunits simultaneously in a heterologous system can facilitate co-translational assembly, as demonstrated in studies where nuclear-expressed AtpB was successfully incorporated into chloroplast ATP synthase complexes .

These approaches have enabled successful reconstitution of partial ATP synthase complexes, allowing investigation of specific aspects of atpB function within the larger enzymatic machinery.

What are the most reliable assays for measuring ATP synthase activity in systems with recombinant Mesorhizobium sp. atpB?

Reliable assessment of ATP synthase activity incorporating recombinant atpB requires assays that can distinguish between ATP synthesis and hydrolysis while accounting for the membrane-bound nature of the complex:

Assay TypeMeasurementAdvantagesLimitations
Luciferin/LuciferaseATP synthesisHigh sensitivity, real-timeIndirect measurement
NADH-coupledATP hydrolysisContinuous monitoringPotential interference
Malachite GreenPi releaseSimple, colorimetricEndpoint measurement
Proton pumpingpH changeDirect functional measurementRequires proteoliposomes
Membrane potentialFluorescenceMonitors ΔΨ componentComplex setup
Oxygen consumptionRespiration couplingPhysiological relevanceRequires intact cells

For reconstituted systems, proton pumping assays using pH-sensitive fluorescent dyes (ACMA, pyranine) provide the most direct measure of atpB function. These assays can detect the establishment of proton gradients even with partial complex assembly or low protein incorporation rates, similar to observations in photosynthetic systems where even 5% of wild-type AtpB levels restored significant functionality .

When comparing wild-type and mutant atpB variants, photosynthetic parameter measurements like Fv/Fm (maximum quantum yield) and NPQ (non-photochemical quenching) have proven effective in plants, while oxygen consumption measurements are more suitable for heterotrophic bacteria like Mesorhizobium .

How might genetic engineering of Mesorhizobium sp. atpB contribute to enhanced bioenergy applications?

Engineering Mesorhizobium sp. atpB offers several promising avenues for bioenergy applications, based on lessons from other ATP synthase engineering efforts:

  • Enhanced ATP synthesis efficiency: Strategic mutations in the proton channel region of atpB could optimize the proton:ATP ratio, potentially increasing energy conversion efficiency in biofuel-producing microorganisms.

  • Stress tolerance engineering: Modifying atpB to maintain functionality under extreme conditions (pH, temperature, salinity) could enable development of robust biocatalysts for industrial bioenergy applications.

  • Cross-species hybrid systems: Creating chimeric ATP synthases that combine the best features from different species, similar to the approach used with G. stearothermophilus and mycobacterial subunits, could yield complexes with novel properties beneficial for biotechnology applications .

  • Nuclear expression strategies: The successful nuclear expression and chloroplast targeting of atpB in plants demonstrates a pathway for engineering ATP synthase components in eukaryotic systems, potentially leading to enhanced photosynthetic efficiency for biofuel feedstock production .

These approaches require detailed understanding of structure-function relationships in atpB, highlighting the importance of fundamental research before applied engineering efforts. Evidence from plant systems suggests that even modest expression levels of engineered ATP synthase components can significantly impact energy metabolism .

What insights can comparative studies of atpB across bacterial species provide about evolution of bioenergetic systems?

Comparative analysis of atpB across bacterial lineages reveals evolutionary adaptations in bioenergetic systems:

  • Selective pressure analysis: Examining patterns of conservation and variation in atpB sequences across bacteria adapted to different ecological niches can identify regions under different selective pressures, revealing functional constraints and adaptive opportunities.

  • Horizontal gene transfer assessment: The presence of atpB on mobile genetic elements in some bacterial species suggests potential for horizontal transfer of bioenergetic components, with implications for the spread of traits like antimicrobial resistance and metabolic capabilities .

  • Structure-function mapping: Correlating structural variations in atpB with functional differences in ATP synthase operation across species can illuminate the molecular basis of adaptation to different energy sources and environmental conditions.

  • Co-evolution patterns: Analyzing how changes in atpB correlate with variations in other ATP synthase subunits across species reveals co-evolutionary constraints that maintain functional interactions within this complex molecular machine.

These comparative approaches have identified unique features like the C-terminal extension in mycobacterial ATP synthase subunit α that regulates ATP hydrolysis, suggesting similar regulatory adaptations may exist in Mesorhizobium sp. atpB that remain to be characterized .

How can structural studies of Mesorhizobium sp. atpB inform the development of new antimicrobial compounds?

Structural characterization of Mesorhizobium sp. atpB provides valuable insights for antimicrobial development:

  • Identification of essential functional motifs: Detailed structural analysis can reveal regions critical for proton translocation or subunit interaction that could serve as targets for inhibitor design, particularly if these regions differ from human ATP synthase counterparts.

  • Species-specific binding pockets: ATP synthase is increasingly recognized as a target for antimicrobial development, with inhibitors like bedaquiline targeting mycobacterial ATP synthase. Similar species-specific binding sites may exist in Mesorhizobium sp. atpB that could be exploited for selective inhibition .

  • Regulatory mechanism targeting: The differential regulation of ATP synthase across bacterial species, such as the unique C-terminal extension in mycobacteria that suppresses ATP hydrolysis, provides opportunities for developing compounds that disrupt these regulatory mechanisms .

  • Structure-based virtual screening: High-resolution structural data enables computational screening of compound libraries to identify potential inhibitors that could then be validated experimentally.

The involvement of ATP synthase in various human diseases, including neuropathy, ataxia, retinitis pigmentosa syndrome, and familial bilateral striatal necrosis, further highlights the importance of species-specific targeting to avoid off-target effects on human ATP synthase .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.