Recombinant Mesorhizobium sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Biological Role of NADH-quinone oxidoreductase subunit K (nuoK)

Complex I (NDH-1) is central to bacterial respiration and phototrophy, with nuoK forming part of its membrane-embedded proton-translocating module . In Mesorhizobium sp., nuoK contributes to:

  • Electron transport: Mediates electron transfer between NADH and quinone pools .

  • Proton pumping: Participates in generating a proton motive force (PMF) essential for ATP synthesis .

  • Structural integrity: Stabilizes interactions between transmembrane helices, particularly via conserved residues like (K)Glu-36 and (K)Glu-72, which are critical for energy-coupled activity .

Functional Insights from Mutagenesis Studies

  • (K)Glu-36 → Ala mutation: Abolishes NADH:quinone oxidoreductase and proton-pumping activities, underscoring its role in energy coupling .

  • (K)Glu-72 → Ala mutation: Reduces activity by ~50%, indicating a secondary role in proton translocation .

  • Loop-1 mutations: Substitutions in (K)Arg-25/(K)Arg-26 disrupt interactions with adjacent subunits, impairing PMF generation .

Phylogenetic and Physiological Relevance

  • Distribution: Complex I (including nuoK) is present in ~52% of bacterial genomes, absent in most archaea .

  • Metabolic versatility: In Mesorhizobium sp., nuoK supports both aerobic respiration and phototrophic growth by regulating quinone pool redox states .

Applications in Research

Recombinant nuoK is used to:

  • Study proton translocation mechanisms via site-directed mutagenesis .

  • Reconstitute minimal Complex I modules for structural analyses (e.g., cryo-EM) .

  • Investigate bacterial respiratory adaptations under varying oxygen conditions .

Challenges and Future Directions

  • Structural dynamics: The membrane-bound nature of nuoK complicates crystallization .

  • Functional redundancy: Some bacteria utilize alternative NADH dehydrogenases (e.g., NDH-2), necessitating conditional knockout studies to isolate nuoK’s role .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; Meso_1032; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Chelativorans sp. (strain BNC1)
Target Names
nuoK
Target Protein Sequence
MEVGIAHYLTVSAVLFTLGIFGIFLNRKNVIIILMSIELILLAVNLNFIAFSAVLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDINMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, ubiquinone is believed to be the direct electron acceptor for the enzyme. The enzyme couples the redox reaction to proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and what is its role in Mesorhizobium species?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the bacterial respiratory chain complex I. In Mesorhizobium species, this membrane-embedded protein participates in energy conservation by coupling electron transfer from NADH to quinones with proton translocation across the membrane. The protein plays a crucial role in the energy metabolism of these nitrogen-fixing bacteria, particularly during symbiotic interactions with legume hosts. The nuoK subunit contains transmembrane helices that form part of the proton translocation pathway essential for energy conservation during respiration .

What are the general characteristics of Mesorhizobium species relevant to nuoK expression?

Mesorhizobium species are soil bacteria belonging to the Rhizobiales order that establish nitrogen-fixing symbioses with various legumes. These bacteria typically have large genomes (ranging from 3.64 to 8.58 Mb) with G+C content between 60.06–66.43% . The genus is phylogenetically complex and recent studies show it to be paraphyletic, forming part of a complex that includes genera such as Aminobacter, Aquamicrobium, Pseudaminobacter, and Tianweitania .

Several Mesorhizobium species possess nitrogen fixation abilities as evidenced by the presence of nodulation (nodABC) and nitrogenase (nifHDK) genes in their genomes. This nitrogen-fixing capability creates a high energy demand, making the efficient function of respiratory complexes including NADH-quinone oxidoreductase particularly important .

How do you assess the conservation of nuoK across different Mesorhizobium species?

The assessment of nuoK conservation requires:

  • Genome sequence alignment analysis: Extract nuoK gene sequences from available Mesorhizobium genomes and perform multiple sequence alignment.

  • Core-proteome analysis: Calculate the core-proteome average amino acid identity (cAAI) which has proven effective in genus classification by minimizing the impact of horizontal gene transfer .

  • Phylogenomic analysis: Construct phylogenetic trees based on both 16S rRNA genes and whole genome sequences to understand the evolutionary relationships.

Analysis of Mesorhizobium genomes reveals that genes essential for respiratory processes like nuoK are generally highly conserved in the chromosome, even when symbiotic genes may be transferred via mobile genetic elements. This conservation suggests functional importance across the genus despite the taxonomic complexity and paraphyletic nature of Mesorhizobium .

What are the optimal conditions for expressing recombinant Mesorhizobium sp. nuoK protein?

Based on analogous membrane protein expression systems and rhizobial protein studies, the following conditions are recommended:

Table 1: Optimal Expression Conditions for Recombinant Mesorhizobium sp. nuoK

ParameterRecommended ConditionRationale
Expression HostE. coli C41(DE3) or C43(DE3)Specialized strains for membrane protein expression
Expression VectorpET-28a(+) with N-terminal His-tagEnables purification via Ni-NTA affinity chromatography
Induction0.1-0.5 mM IPTG at OD600 of 0.6-0.8Lower IPTG concentration reduces toxicity
Growth Temperature16-18°C post-inductionSlower expression improves proper membrane insertion
Growth MediumTerrific Broth with 1% glucoseGlucose represses basal expression; rich medium supports growth
Membrane ExtractionDetergent screening (DDM, LMNG, etc.)Membrane proteins require optimization of detergent conditions

The expression system should include a cleavable His-tag for purification, similar to approaches used for other recombinant proteins from Mesorhizobium species . Post-purification, the protein should be stored with 5-50% glycerol at -80°C to maintain stability .

What cloning strategy is most effective for recombinant Mesorhizobium sp. nuoK construction?

An effective cloning strategy involves:

  • Gene synthesis or PCR amplification: Codon-optimized synthesis for E. coli is recommended, as Mesorhizobium has different codon usage patterns.

  • Restriction enzyme digestion and ligation: Using NdeI and XhoI restriction sites for directional cloning into the expression vector .

  • Transformation into cloning strain: Initial transformation into E. coli DH5α for plasmid propagation.

  • Verification by sequencing: Confirm the insert sequence before proceeding to expression.

  • Transformation into expression strain: Transfer the verified construct to the expression host.

When designing primers for PCR amplification, include:

  • A Kozak-like sequence (AAGGAG) before the start codon

  • Appropriate restriction sites with 3-6 base pair overhangs

  • Consideration of the reading frame with the tag sequence

This approach has proven successful for membrane proteins from various bacterial sources including rhizobial species .

What purification methods yield the highest purity of functional nuoK protein?

The following multi-step purification protocol is recommended:

Table 2: Purification Protocol for Recombinant Mesorhizobium sp. nuoK

Purification StepConditionsExpected Outcome
Membrane IsolationUltracentrifugation at 100,000×g for 1hMembrane fraction containing nuoK
Solubilization1% DDM or LMNG, 4°C for 2hExtracted membrane proteins
Ni-NTA Affinity20 mM imidazole wash, 250 mM imidazole elutionRemoval of major contaminants
Size ExclusionSuperdex 200 column in 0.05% detergentSeparation of aggregates and final purification
Quality ControlSDS-PAGE and Western blot>95% purity
Activity AssayNADH oxidation (340 nm)Confirmation of functionality

This protocol is designed based on successful approaches for other membrane-bound respiratory proteins. The critical step is detergent selection, which may require screening several options to maintain the protein in a native-like, functional state .

How does the structure of Mesorhizobium sp. nuoK compare to homologous proteins in other bacteria?

While no crystal structure specific to Mesorhizobium sp. nuoK is currently available in the literature, structural predictions can be made based on homology modeling with related bacterial complex I structures. Analysis suggests:

  • Transmembrane domain organization: Mesorhizobium sp. nuoK likely contains three transmembrane helices arranged in a similar pattern to those observed in other bacterial complex I structures.

  • Conserved residues: Key residues involved in proton translocation pathways are expected to be conserved, particularly those forming the central hydrophilic axis.

  • Structural differences: Comparison with the related NADH-quinone oxidoreductase from Helicobacter pylori suggests potential species-specific adaptations in the membrane-spanning regions .

The analysis of residue conservation patterns can identify functionally important sites. Based on similar proteins, residues like lysine and asparagine that interact with NADH in related oxidoreductases (e.g., N85 in Gh-ChrR) are likely conserved in Mesorhizobium sp. nuoK to maintain the interaction with the nicotinamide ring of NADH .

What is the relationship between nuoK expression and nitrogen fixation in Mesorhizobium symbiosis?

The relationship between nuoK expression and nitrogen fixation involves complex regulatory networks:

  • Energy requirements: Nitrogen fixation is highly energy-demanding, requiring efficient respiratory chain function. nuoK expression likely increases during active nitrogen fixation to support ATP production.

  • Oxygen regulation: Both nitrogen fixation and respiratory chain components are regulated by oxygen availability. Low oxygen conditions in root nodules influence the expression profile of respiratory chain components including nuoK.

  • Genomic integration: While symbiotic genes in Mesorhizobium are often located on mobile genetic elements like ICESyms (integrative and conjugative elements), core respiratory genes like nuoK typically remain on the chromosome. This separation suggests different evolutionary pressures on these functional gene sets .

Research on non-symbiotic Mesorhizobium strains has shown that following acquisition of symbiotic genetic elements, they can establish nitrogen-fixing symbioses, indicating that the core genome (including respiratory components like nuoK) is generally compatible with symbiotic functions across the genus .

How can site-directed mutagenesis of nuoK provide insights into proton translocation mechanisms?

Site-directed mutagenesis of nuoK can elucidate critical aspects of proton translocation through targeted modifications:

Table 3: Key Residues for Site-Directed Mutagenesis in nuoK

Target Residue TypePotential MutationExpected EffectAnalysis Method
Charged residues (Lys, Glu)Ala or charge reversalDisruption of proton pathwayNADH oxidation assays
Conserved hydrophobic residuesAla or PheAltered conformational dynamicsMembrane potential measurements
Potential quinone-binding residuesTyr→Phe, Ser→AlaModified quinone interactionEnzyme kinetics

Based on analogous studies with other oxidoreductases, mutations like N85A in Gh-ChrR resulted in a 3-fold larger apparent Km value compared to wild type, indicating reduced binding affinity for NADH . Similar approaches with Mesorhizobium sp. nuoK could reveal:

  • Proton translocation pathways: Identifying residues critical for proton movement across the membrane

  • Conformational changes: Understanding how electron transfer is coupled to proton translocation

  • Quinone binding determinants: Elucidating specificity for different quinone types

This approach would significantly advance our understanding of the structure-function relationship in this important respiratory chain component .

What bioinformatic approaches are most effective for analyzing nuoK sequence variation across Mesorhizobium species?

The most effective bioinformatic approaches for analyzing nuoK sequence variation include:

When applied to Mesorhizobium species, these approaches have revealed that core metabolic genes show different evolutionary patterns compared to symbiotic genes, with respiratory genes like nuoK typically showing strong conservation due to their essential function in cellular energy production .

How do you interpret kinetic data from recombinant nuoK enzyme activity assays?

Interpreting kinetic data requires analyzing several parameters:

Table 4: Kinetic Parameters and Their Interpretation for nuoK

ParameterCalculation MethodInterpretation
Km for NADHMichaelis-Menten or Lineweaver-Burk plotBinding affinity for electron donor
VmaxCurve fitting to Michaelis-Menten equationMaximum catalytic rate
kcatVmax/[Enzyme]Catalytic efficiency
kcat/KmRatio calculationSpecificity constant
Inhibition patternsInhibition kinetics analysisSubstrate/product inhibition mechanisms

For proper interpretation:

  • Substrate inhibition: As observed with related oxidoreductases, NADH may act as a substrate inhibitor. This requires analyzing data with appropriate models that account for substrate inhibition .

  • Binding order: Establish whether the mechanism follows an ordered binding (e.g., chromate binding prior to NADH association) or random binding .

  • pH and temperature effects: Analyze activity across pH and temperature ranges to determine optimal conditions and understand the influence of protonation states on catalysis.

  • Comparison with wild-type enzyme: When analyzing mutants, compare kinetic parameters to wild-type to quantify the impact of specific residues on function .

What approaches can resolve discrepancies between in vitro and in vivo nuoK functional data?

Resolving discrepancies between in vitro and in vivo functional data requires systematic investigation:

  • Membrane mimetic optimization: Test different detergents or reconstitution into liposomes to better approximate the native membrane environment of nuoK.

  • Partner protein co-expression: Express nuoK with interacting subunits of complex I to maintain natural protein-protein interactions that may be critical for function.

  • Post-translational modification analysis: Identify potential modifications present in vivo but absent in recombinant systems.

  • Genetic complementation assays: Perform complementation studies in Mesorhizobium mutants lacking functional nuoK to verify activity in the native environment.

  • Comparative analysis with whole complex: Compare isolated nuoK activity with that of the entire complex I to understand the impact of subunit interactions.

When differences are observed, consider the physiological context: in vivo, nuoK functions within the membrane with specific quinone types and under varying oxygen tensions that are difficult to replicate in vitro .

What strategies address low expression yields of recombinant Mesorhizobium sp. nuoK?

Low expression yields can be addressed through several strategies:

Table 5: Troubleshooting Strategies for Low nuoK Expression

ChallengeStrategyExpected Outcome
Toxicity during expressionUse tightly regulated promoters (e.g., pBAD)Reduced basal expression
Codon usage issuesCodon optimization for expression hostImproved translation efficiency
Protein misfoldingLower induction temperature (16°C)Slower expression allowing proper folding
DegradationAdd protease inhibitors; use protease-deficient strainsReduced proteolytic degradation
Inclusion body formationCo-express molecular chaperones (GroEL/ES)Improved solubility
Poor membrane insertionAdd fusion partners (e.g., GFP) to monitor foldingBetter tracking of properly folded protein

Additional considerations include:

  • Auto-induction media: Provides gradual induction and higher cell densities

  • Fusion tags: Addition of solubility-enhancing tags like MBP or SUMO

  • Sequential expression: Stepwise expression of complex I components

For long-term storage of successfully expressed protein, adding 5-50% glycerol and storing at -80°C is recommended to maintain stability .

How do you address specificity challenges in functional assays for recombinant nuoK?

Addressing specificity challenges requires careful assay design:

  • Control experiments:

    • Use denatured enzyme as negative control

    • Include known inhibitors to verify specificity

    • Perform assays with purified NADH dehydrogenase from different sources as comparison

  • Substrate analogs:

    • Test structurally similar compounds to NADH to confirm specificity

    • Use different quinone types to assess preference

  • Coupled assay systems:

    • Develop coupled spectrophotometric assays that directly measure quinone reduction

    • Use artificial electron acceptors with defined redox potentials

  • Direct measurement techniques:

    • Employ protein film voltammetry to directly measure electron transfer

    • Use isothermal titration calorimetry to quantify binding events

When interpreting results, be aware that catalysis may require specific binding orders (e.g., chromate binding prior to NADH association, as observed in related systems) .

What methods can differentiate between functional and non-functional recombinant nuoK variants?

Differentiating functional variants requires multiple complementary approaches:

  • Enzymatic activity assays:

    • NADH oxidation rate measurement (monitoring absorbance at 340 nm)

    • Quinone reduction assays with various quinone substrates

    • Oxygen consumption measurements

  • Structural integrity assessment:

    • Circular dichroism to analyze secondary structure

    • Limited proteolysis to verify proper folding

    • Thermostability assays to determine protein stability

  • Membrane integration verification:

    • Flotation assays in density gradients

    • Protease accessibility tests for properly oriented membrane proteins

    • Fluorescence-based assays for membrane localization

  • In vivo complementation:

    • Transform nuoK-deficient bacteria with variant constructs

    • Assess restoration of respiratory growth

    • Measure proton translocation in whole cells

  • Ligand binding assays:

    • Isothermal titration calorimetry for NADH binding

    • Differential scanning fluorimetry with and without substrates

When assessing functionality, it's important to consider that even minor structural changes can significantly impact complex I assembly and function, potentially leading to false negatives in isolated subunit assays .

How might systems biology approaches enhance our understanding of nuoK function in Mesorhizobium metabolism?

Systems biology approaches offer powerful tools for understanding nuoK in the broader context of Mesorhizobium metabolism:

These approaches could reveal:

  • How respiratory chain function is integrated with nitrogen fixation pathways

  • Regulatory mechanisms that coordinate energy production with symbiotic processes

  • Differences in respiratory chain utilization between free-living and symbiotic states

What emerging technologies show promise for structural studies of Mesorhizobium sp. nuoK?

Several emerging technologies offer new opportunities for structural studies:

  • Cryo-electron microscopy:

    • Single-particle analysis for high-resolution structures of intact complex I

    • Tomography for visualizing membrane protein complexes in their native environment

    • Time-resolved studies capturing different conformational states

  • Integrative structural biology:

    • Combining X-ray crystallography, NMR, and computational modeling

    • Cross-linking mass spectrometry to map protein-protein interfaces

    • Hydrogen-deuterium exchange mass spectrometry for dynamics information

  • Advanced computational approaches:

    • AI-based structure prediction tools like AlphaFold2

    • Molecular dynamics simulations of membrane-embedded nuoK

    • Enhanced sampling techniques to study conformational changes

  • Lipid nanodisc technology:

    • Reconstitution of nuoK into nanodiscs for a more native-like environment

    • Compatibility with various structural and functional studies

    • Controlled lipid composition to study lipid-protein interactions

These technologies could reveal the structural basis of proton translocation and provide insights into how electron transfer is coupled to proton movement across the membrane .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.