Recombinant Mesorhizobium sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular Composition and Production

Recombinant Mesorhizobium sp. HtpX is a full-length protein (313 amino acids) fused to an N-terminal His tag for purification convenience. It is expressed in Escherichia coli and retains the structural and functional features of its native homolog .

Key features:

  • UniProt ID: Q11CT7

  • Gene Locus: Meso_3417

  • Expression System: E. coli

  • Tag: His tag (position varies based on production batch)

ParameterSpecification
Molecular Weight~35 kDa (theoretical)
Storage BufferTris-based buffer with 50% glycerol
Storage Recommendations-20°C (short-term); -80°C (long-term)
Purity>90% (SDS-PAGE verified)

Enzymatic Activity

HtpX belongs to the M48 peptidase family and functions as a zinc-dependent endoprotease . Its catalytic activity centers on the HEXXH motif, a conserved zinc-binding domain critical for proteolysis .

  • Substrates: Degrades casein, misfolded membrane proteins (e.g., SecY), and undergoes self-cleavage .

  • Cofactor Requirement: Zn²⁺ is essential for activity; chelators like EDTA inhibit function .

  • pH Optimum: Functions optimally under neutral to slightly alkaline conditions .

Protein Quality Control

HtpX collaborates with FtsH, an ATP-dependent protease, to degrade misfolded membrane proteins under stress conditions (e.g., heat shock) . This partnership ensures cellular homeostasis by preventing toxic protein aggregation.

Stress Response Regulation

Expression of HtpX is upregulated by the Cpx stress response system, which detects envelope stress . This regulatory link positions HtpX as a key player in bacterial survival under adverse conditions.

Role in Antibiotic Resistance

Recent studies highlight HtpX’s involvement in intrinsic aminoglycoside resistance. In Stenotrophomonas maltophilia, HtpX and ClpA proteases jointly mitigate antibiotic-induced protein damage, reducing drug efficacy .

StrainKanamycin MIC (μg/mL)Tobramycin MIC (μg/mL)
Wild-Type25664
ΔHtpX Mutant6416
ΔClpAΔHtpX Double Mutant164

In Vitro Studies

  • SecY Cleavage Assays: Purified HtpX cleaves solubilized SecY, a membrane-integrated translocon, confirming its role in membrane protein turnover .

  • Casein Degradation: Used to quantify proteolytic activity in zinc-supplemented buffers .

Drug Target Potential

HtpX inhibitors could potentiate aminoglycoside antibiotics by disrupting bacterial stress adaptation .

Challenges and Future Directions

  • Instability: HtpX undergoes rapid self-degradation upon membrane solubilization, complicating purification .

  • Structural Studies: High-resolution structures are needed to elucidate substrate recognition mechanisms.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
htpX; Meso_3417; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Chelativorans sp. (strain BNC1)
Target Names
htpX
Target Protein Sequence
MNMIRTAMLLAFMTALFMAVGYLIGGSGGMMIALVIAAAMNLFSYWNADKMVLRMHHAVE VDERSAPEYYRIVSDLAQRAGLPMPRVYVIDNPQPNAFATGRNPQNAAVAATTGLLHSLT PEEVAGVMAHELAHVQNRDTLTMTITATLAGAISMLGNFAFFFGGNRDNNNPFGFIGILV AMIVAPLAAMVVQMAISRTREYAADRRGAEICGQPLWLASALAKISRAAHRVVNVDAERN PATAHLFIINPLSGQRMDNLFSTHPNTENRIAALQAMAGEFGNAPPASLREDEPGADGPW GRSASRARKGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of HtpX in bacterial systems?

HtpX functions as a membrane-bound zinc metalloprotease involved in the proteolytic quality control of membrane proteins. In Escherichia coli, HtpX works in conjunction with FtsH (another membrane-bound and ATP-dependent protease) to maintain membrane protein homeostasis. The enzyme exhibits proteolytic activities against both membrane and soluble proteins, demonstrating its versatility in protein degradation pathways . In symbiotic bacteria like Mesorhizobium sp., HtpX homologs likely perform similar quality control functions, potentially with adaptations specific to their symbiotic lifestyle and environmental challenges.

How is HtpX structurally characterized?

HtpX is an integral membrane metallopeptidase with zinc-dependent endoprotease activity. The protein contains transmembrane domains that anchor it within the bacterial membrane, with catalytic domains positioned to access substrate proteins. The active site includes zinc-binding motifs essential for its proteolytic function . When purifying HtpX for structural studies, researchers must maintain proper folding while extracting it from the membrane environment, typically using detergents like octyl-β-d-glucoside to preserve the native conformation .

What are the known substrates of HtpX proteases?

Research has identified several substrates for HtpX proteases. In E. coli, HtpX has been shown to cleave SecY, a membrane protein involved in protein translocation . Additionally, HtpX can degrade casein, demonstrating its ability to process soluble proteins in addition to membrane-embedded substrates . For Mesorhizobium sp. HtpX homologs, researchers should consider potential symbiosis-specific substrates that might be involved in plant-microbe interactions, though these would need experimental verification through targeted proteomic approaches.

What are the optimal expression systems for recombinant Mesorhizobium sp. HtpX?

For recombinant expression of membrane proteins like HtpX, E. coli BL21(DE3) has proven effective when using pET-derived vectors with C-terminal His-tags for purification . When working with Mesorhizobium sp. HtpX homologs, codon optimization may be necessary if rare codons are present in the target gene. Temperature optimization is crucial, with lower temperatures (16-25°C) often yielding better results for membrane protein expression by reducing aggregation and inclusion body formation. Additionally, induction conditions should be carefully titrated, starting with lower IPTG concentrations (0.1-0.5 mM) to prevent overwhelming the membrane insertion machinery.

How can researchers overcome challenges in purifying membrane-bound HtpX proteases?

Purification of HtpX requires specialized techniques due to its membrane-embedded nature. A multi-step purification strategy has been successful, involving:

  • Membrane extraction using detergents (octyl-β-d-glucoside has shown effectiveness)

  • Metal affinity chromatography (cobalt-affinity columns with His-tagged constructs)

  • Anion-exchange chromatography for removing contaminants

  • Size-exclusion chromatography as a final polishing step

For Mesorhizobium sp. HtpX homologs, detergent screening may be necessary to identify the optimal extraction condition that maintains enzymatic activity. During all purification steps, including zinc or other divalent metal ions in the buffers may help maintain the metalloprotease in its properly folded state.

What strategies can prevent self-degradation of HtpX during purification?

HtpX undergoes self-degradation upon cell disruption or membrane solubilization, presenting a significant challenge during purification . To overcome this, researchers should consider:

  • Purifying under denaturing conditions followed by controlled refolding in the presence of zinc chelators

  • Using catalytically inactive mutants (e.g., mutations in the zinc-binding motifs) for structural studies

  • Including protease inhibitors specific for metalloproteases during early extraction steps

  • Performing purification rapidly at 4°C to minimize self-proteolysis

  • Adding zinc back to the refolded protein to restore activity when needed for functional assays

These approaches have been successful with E. coli HtpX and can be adapted for Mesorhizobium sp. homologs.

How can site-directed mutagenesis be applied to study functional domains of Mesorhizobium HtpX?

Site-directed mutagenesis of HtpX can be performed using a two-step PCR method as demonstrated in previous studies . To investigate catalytic residues and functional domains:

  • Design primers containing mutation sites in the middle of their sequences

  • Perform initial PCR with Fast Pfu DNA polymerase using genomic DNA as template

  • Use the PCR fragments as megaprimers with plasmid templates containing the wild-type gene

  • Transform the resulting constructs into expression hosts lacking the endogenous gene

Target residues should include the conserved zinc-binding motifs (typically HEXXH sequences) and other residues predicted to be involved in substrate recognition based on sequence alignments with characterized HtpX proteins. For functional validation, complementation assays in deletion strains can reveal whether the mutated proteins retain their physiological activity.

What transcriptomic approaches can reveal the regulatory network of htpX in Mesorhizobium species?

Based on studies in related bacterial systems, microarray or RNA-seq analyses comparing wild-type and htpX mutant strains under various stress conditions can reveal the regulatory networks of htpX . For Mesorhizobium species:

  • Generate htpX deletion mutants using homologous recombination techniques

  • Culture both wild-type and mutant strains under relevant stress conditions (pH stress, temperature stress, metal stress)

  • Extract RNA at defined time points after stress exposure

  • Perform transcriptomic analysis to identify differentially expressed genes

  • Validate key findings with qRT-PCR and functional assays

This approach has successfully revealed that rpoH sigma factors regulate stress responses in related alpha-proteobacteria like Sinorhizobium meliloti, and similar regulatory relationships may exist for htpX in Mesorhizobium species .

How can proteomics be used to identify HtpX substrates in Mesorhizobium?

To identify physiological substrates of HtpX proteases in Mesorhizobium species, researchers can employ comparative proteomics approaches:

  • Generate catalytically inactive HtpX variants that can bind but not cleave substrates (substrate trapping)

  • Compare membrane proteome profiles between wild-type, htpX deletion, and catalytically inactive htpX expression strains

  • Identify proteins that accumulate in the deletion strain or interact with the inactive HtpX variant

  • Validate potential substrates through in vitro cleavage assays with purified components

  • Confirm physiological relevance through genetic complementation studies

This strategy has been effective for identifying substrates of membrane proteases in other bacterial systems and could be applied to Mesorhizobium sp. to understand HtpX's role in symbiosis-related processes.

How can researchers overcome poor expression yields of recombinant HtpX?

Poor expression yields of membrane proteins like HtpX are common. To address this challenge:

  • Test multiple E. coli expression strains (BL21, C41, C43, Lemo21) specifically developed for membrane protein expression

  • Optimize growth media composition (adding glycerol, reducing phosphate concentration)

  • Use fusion partners that enhance membrane protein folding (e.g., GFP, MBP)

  • Implement co-expression with chaperones like GroEL/ES to improve folding efficiency

  • Consider cell-free expression systems that can directly incorporate detergent micelles or nanodiscs

For Mesorhizobium sp. HtpX homologs, expression in the native organism might provide better yields in some cases, particularly if specific cofactors or binding partners are needed for proper folding.

What methods can verify the proper folding and activity of purified HtpX?

Verifying proper folding and activity of purified HtpX is essential for meaningful functional studies. Researchers should:

  • Assess secondary structure using circular dichroism spectroscopy to confirm proper folding

  • Verify zinc binding using inductively coupled plasma mass spectrometry (ICP-MS)

  • Perform activity assays using known substrates (e.g., casein or SecY for E. coli HtpX)

  • Assess thermal stability through differential scanning fluorimetry to confirm proper folding

  • Use size-exclusion chromatography to verify the absence of aggregation

For Mesorhizobium sp. HtpX homologs, developing specific activity assays based on potential physiological substrates may be necessary, particularly if their substrate specificity differs from E. coli HtpX.

How should researchers address the loss of activity during purification and storage?

Loss of activity during purification and storage is a common challenge with metalloproteases like HtpX. To mitigate this:

  • Include zinc or other appropriate divalent metal ions in all purification and storage buffers

  • Maintain reducing conditions to prevent oxidation of cysteine residues

  • Store purified protein at higher concentrations (>1 mg/ml) to reduce surface denaturation

  • Add glycerol (10-20%) to storage buffers to enhance stability during freeze-thaw cycles

  • Consider flash-freezing aliquots in liquid nitrogen rather than slow freezing

  • Test stabilizing additives like specific lipids that may maintain the native membrane environment

Activity assays should be performed immediately after purification and periodically during storage to monitor stability under different conditions.

How do environmental stresses regulate htpX expression in Mesorhizobium species?

Environmental stress responses in symbiotic bacteria are crucial for understanding their adaptation mechanisms. To investigate htpX regulation:

  • Perform time-course experiments exposing Mesorhizobium cultures to relevant stresses (pH shift, temperature, oxidative stress, metal toxicity)

  • Monitor htpX transcript levels using qRT-PCR

  • Use reporter gene fusions (htpX promoter-GFP) to visualize expression patterns in different conditions

  • Identify transcription factors that bind the htpX promoter region using DNA-protein interaction assays

  • Characterize the role of sigma factors (particularly RpoH homologs) in htpX expression

Research in S. meliloti has shown that RpoH1 plays a critical role in pH stress response, and similar mechanisms might regulate htpX expression in Mesorhizobium species under stress conditions .

What role does HtpX play in symbiotic interactions of Mesorhizobium with host plants?

The function of HtpX in plant-microbe symbiosis remains largely unexplored but represents an important research direction:

  • Generate htpX deletion mutants in Mesorhizobium sp. and assess their nodulation efficiency on host plants

  • Compare plant growth parameters between wild-type and htpX mutant inoculations

  • Use microscopy to examine nodule development and bacteroid differentiation

  • Perform transcriptomics on bacteroids to identify pathways affected by htpX deletion

  • Investigate whether HtpX processes specific symbiosis-related proteins during nodule development

This approach could reveal whether HtpX plays a specialized role in symbiotic processes beyond its general protein quality control function.

How do HtpX homologs contribute to metal stress resistance in Mesorhizobium?

Based on studies showing involvement of proteases in metal stress resistance , researchers can investigate HtpX's role in metal tolerance:

  • Compare growth of wild-type and htpX mutant Mesorhizobium strains under various metal stresses

  • Determine minimum inhibitory concentrations of different metals for both strains

  • Analyze changes in the membrane proteome under metal stress conditions

  • Investigate whether HtpX cleaves specific proteins that accumulate during metal exposure

  • Explore potential interactions between HtpX and other stress response systems

Such studies could reveal whether HtpX homologs in Mesorhizobium contribute to cadmium resistance similar to what has been observed in other bacterial systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.