Recombinant Mesorhizobium sp. UPF0283 membrane protein Meso_1416 (Meso_1416)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Meso_1416; UPF0283 membrane protein Meso_1416
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Chelativorans sp. (strain BNC1)
Target Names
Meso_1416
Target Protein Sequence
MSEPRRPAAFRIEPAPSPSPEATREDVRKPRAIRVDEAVKITPAEIDIFDSLETEASAPP PAAAPKRRSRLGAVFVAALGMLVSLAAGLWADSLIRDLFSRADWLGWLGAALVAVAALAL FAIVVREAIAVARLASVERMRRRSDDAYERDDARQARAVIADLSSLLASHPDTAAGRRQL EQLEGDVIDGRDLLRIAEKELLAPLDKRAQKLVLDAAKRVSVVTAVSPRALMDVGYVIFE AVRLLRRLSELYCGRPGFFGFLRLSRNVLAHLAVTGSMAMGDTIVQQIVGHGIAARLSAR LGEGVVNGMMTARIGMAAISAIRPLSFRAVERPGIGDFLKALTQFAAKTDGKRT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should researchers approach experimental characterization of Meso_1416?

For initial characterization, employ a multi-method approach:

  • Membrane topology analysis: Use PhoA/LacZ fusion constructs to determine orientation of protein domains relative to the membrane

  • Subcellular localization: Utilize fluorescent protein tags (GFP/mCherry) combined with confocal microscopy

  • Biochemical preparation: Extract using a Tris-based buffer system with detergents like DDM or LDAO to maintain native conformation

  • Storage optimization: Maintain in 50% glycerol at -20°C for short-term or -80°C for long-term stability

For structural studies, protein should be expressed in systems capable of proper folding and insertion of bacterial membrane proteins, such as E. coli BL21(DE3) with specialized vectors containing membrane protein-specific signal sequences.

What expression systems yield optimal results for recombinant Meso_1416 production?

Recommended expression systems by effectiveness:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coli BL21(DE3)Cost-effective, rapid growthLimited post-translational modifications2-5
E. coli C41/C43Specialized for membrane proteinsRequires optimization3-7
Mesorhizobium nativeNatural folding environmentComplex media requirements1-3
Cell-free systemsAvoids toxicity issuesHigher cost, lower yield0.5-2

Methodology:

  • For E. coli systems, use induction with 0.1-0.5 mM IPTG at reduced temperatures (18-25°C)

  • Integrate membrane protein-specific tags (e.g., MISTIC, YidC) to improve membrane insertion

  • Consider codon optimization for heterologous expression systems

The addition of membrane-stabilizing agents such as glycerol (5-10%) in the culture medium can improve expression yields by enhancing membrane integrity during protein production .

What purification challenges are specific to Meso_1416 and how can they be addressed?

Purification of Meso_1416 presents challenges common to membrane proteins, requiring specialized approaches:

  • Membrane extraction:

    • Optimize detergent screening using a panel including DDM, LDAO, FC-12, and LMNG

    • Implement selective solubilization using 50 mM Tris-HCl pH 7.5, 150 mM NaCl with detergent concentrations 2-3× CMC

  • Chromatography strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) with His-tag

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography in detergent micelles

  • Quality assessment:

    • Use dynamic light scattering to evaluate homogeneity

    • Employ circular dichroism to verify secondary structure integrity

    • Apply SDS-PAGE with western blotting to confirm purity

A critical consideration is detergent exchange during purification, as different detergents may be optimal for extraction versus crystallization or functional studies .

What methodologies can determine the function of this uncharacterized UPF0283 family protein?

Given the limited functional data on UPF0283 family proteins, a multi-pronged approach is recommended:

  • Genetic approaches:

    • Generate knockout strains using CRISPR/Cas9 or traditional homologous recombination

    • Analyze phenotypic changes in growth, membrane integrity, and symbiotic capacity

    • Perform complementation studies with wild-type and mutated versions

  • Protein interaction studies:

    • Employ bacterial two-hybrid screening to identify interaction partners

    • Use co-immunoprecipitation with tagged Meso_1416 followed by mass spectrometry

    • Apply proximity labeling techniques (BioID, APEX) to identify transient interactions

  • Comparative genomics:

    • Analyze synteny of the genomic region containing meso_1416 across related species

    • Identify co-expression patterns with genes of known function

    • Examine conservation patterns of specific residues to infer functional domains

  • Biochemical approaches:

    • Test for transmembrane transport activities using liposome reconstitution

    • Assess potential enzymatic activities through substrate screening

    • Examine membrane remodeling capabilities through lipid interaction studies

How can researchers investigate potential roles of Meso_1416 in Mesorhizobium symbiosis?

The involvement of Meso_1416 in symbiotic processes can be investigated through:

  • Plant infection assays:

    • Inoculate legume host plants with wild-type versus Meso_1416 knockout strains

    • Quantify nodulation efficiency, nitrogen fixation rates, and plant growth parameters

    • Perform competitive nodulation assays between wild-type and mutant strains

  • Transcriptomic analysis:

    • Compare gene expression profiles between free-living and symbiotic states

    • Analyze co-expression networks to identify functional associations

    • Examine differential expression under various symbiotic stresses

  • Microscopy techniques:

    • Apply fluorescence microscopy to track localization during symbiotic stages

    • Use electron microscopy to examine membrane structures in bacteroids

    • Implement live-cell imaging to observe dynamic changes during infection

  • Signal transduction analysis:

    • Investigate potential roles in quorum sensing pathways

    • Examine involvement in exopolysaccharide production

    • Assess contributions to type III secretion system functioning

What are optimal approaches for determining the three-dimensional structure of Meso_1416?

Structural determination of membrane proteins requires specialized techniques:

  • X-ray crystallography:

    • Implement lipidic cubic phase (LCP) crystallization

    • Screen detergent/lipid combinations systematically

    • Consider fusion partners (T4 lysozyme, BRIL) to enhance crystallization

  • Cryo-electron microscopy:

    • Apply single-particle analysis for higher molecular weight complexes

    • Use nanodisc reconstitution to maintain native lipid environment

    • Implement phase plate technology to enhance contrast

  • NMR spectroscopy:

    • Produce isotopically labeled protein (13C, 15N) in minimal media

    • Apply solid-state NMR for membrane-embedded structure determination

    • Utilize selective labeling strategies to focus on specific domains

  • Hybrid approaches:

    • Combine limited proteolysis with mass spectrometry to identify domains

    • Implement hydrogen-deuterium exchange to map solvent-accessible regions

    • Apply cross-linking coupled with mass spectrometry to identify proximity relationships

How can computational methods complement experimental structural studies of Meso_1416?

Computational approaches provide valuable insights when experimental data is limited:

  • Structure prediction:

    • Apply AlphaFold2 or RoseTTAFold for ab initio structure prediction

    • Use SWISS-MODEL for homology modeling if structural homologs exist

    • Implement metagenomic structural modeling using multiple sequence alignments

  • Molecular dynamics simulations:

    • Perform all-atom simulations in explicit membrane environments

    • Model protein-lipid interactions to identify potential binding sites

    • Simulate conformational changes under various conditions

  • Integrative modeling:

    • Combine low-resolution experimental data with computational predictions

    • Implement Bayesian integrative modeling incorporating multiple data sources

    • Apply normal mode analysis to predict potential conformational flexibility

  • Function prediction:

    • Use structure-based function prediction algorithms

    • Apply binding site prediction tools to identify potential ligand pockets

    • Analyze electrostatic surface potential to infer functional sites

How conserved is Meso_1416 across bacterial species and what does this suggest about its function?

Evolutionary analysis reveals important functional implications:

  • Conservation pattern:

    • UPF0283 family proteins are conserved across alpha-proteobacteria

    • Core structural elements show higher conservation than peripheral regions

    • Transmembrane domains exhibit stronger sequence constraints than soluble domains

  • Phylogenetic distribution:

    • Present in most Mesorhizobium species with 70-95% sequence identity

    • Found in related Rhizobiaceae with 50-70% sequence identity

    • More distant homologs (30-50% identity) in other alpha-proteobacteria

  • Functional implications:

    • Conservation within symbiotic bacteria suggests potential roles in host interaction

    • Co-evolution with other membrane systems may indicate functional association

    • Selective pressure analysis reveals potentially critical functional residues

The evolutionary trajectory of Meso_1416 aligns with the broader reclassification of the Mesorhizobium genus, which recent phylogenomic analyses have shown to be paraphyletic, forming part of a complex that includes the genera Aminobacter, Aquamicrobium, Pseudaminobacter, and Tianweitania .

What can comparative genomics reveal about the genomic context and potential function of meso_1416?

Genomic context analysis provides functional insights through:

  • Synteny analysis:

    • Examination of conserved gene neighborhoods across species

    • Identification of operonic structures suggesting coordinated expression

    • Analysis of regulatory elements in the promoter region

  • Co-occurrence patterns:

    • Correlation between presence/absence of meso_1416 and other genes

    • Association with specific metabolic pathways or cellular functions

    • Relationship to symbiotic gene clusters or mobile genetic elements

  • Pangenome analysis:

    • Determination whether meso_1416 belongs to core or accessory genome

    • Correlation with ecological niches or host plant associations

    • Relationship to horizontally transferred elements like ICESyms

  • Transcriptomic correlation:

    • Integration of expression data to identify co-regulated genes

    • Analysis of expression patterns under symbiotic versus free-living conditions

    • Identification of potential regulatory networks

How can researchers investigate the membrane dynamics and trafficking of Meso_1416?

To study membrane dynamics and trafficking of Meso_1416, implement these advanced approaches:

  • Live-cell imaging techniques:

    • Use photoactivatable fluorescent protein fusions for pulse-chase imaging

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to measure lateral mobility

    • Implement single-molecule tracking to analyze diffusion characteristics

  • Membrane microdomain association:

    • Utilize detergent-resistant membrane fraction isolation

    • Apply super-resolution microscopy (PALM/STORM) to visualize nanoscale distribution

    • Use proximity labeling to identify lipid raft association partners

  • Protein turnover analysis:

    • Implement cycloheximide chase assays to determine half-life

    • Use ubiquitination site mapping to identify degradation signals

    • Apply ESCRT-dependency assays to determine internalization mechanisms

    • Analyze potential roles of NEDD4-family E3 ligases in regulation

  • Trafficking pathway identification:

    • Employ dominant-negative Rab GTPases to block specific trafficking routes

    • Use temperature blocks to arrest at different trafficking stages

    • Apply organelle-specific markers to track co-localization during biogenesis

What cutting-edge techniques can elucidate the role of Meso_1416 in bacterial membrane organization?

The most advanced approaches for studying membrane organization include:

  • Cryogenic electron tomography:

    • Image whole bacterial cells in near-native states

    • Visualize membrane protein complexes in situ

    • Generate 3D reconstructions of membrane architecture

  • Native mass spectrometry:

    • Analyze intact membrane protein complexes

    • Determine stoichiometry and composition of assemblies

    • Identify lipid interactions maintaining complex stability

  • Advanced labeling strategies:

    • Implement unnatural amino acid incorporation for site-specific labeling

    • Apply click chemistry approaches for minimal perturbation labeling

    • Use genetically encoded proximity sensors to map nanoscale organization

  • Correlative light and electron microscopy (CLEM):

    • Combine functional fluorescence imaging with ultrastructural analysis

    • Track dynamic processes followed by high-resolution snapshots

    • Implement in situ labeling techniques for molecular identification

  • Biophysical membrane characterization:

    • Apply solid-state NMR to study membrane protein-lipid interactions

    • Use neutron reflectometry to analyze membrane thickness changes

    • Implement atomic force microscopy to map surface topology and mechanical properties

How can researchers investigate potential roles of Meso_1416 in bacterial stress responses?

To explore stress response roles, implement these methodological approaches:

  • Stress challenge experiments:

    • Compare survival of wild-type versus knockout strains under diverse stresses:

      • Osmotic stress (high salt, osmolytes)

      • Oxidative stress (H₂O₂, paraquat)

      • pH stress (acidic and alkaline conditions)

      • Membrane perturbants (detergents, antimicrobial peptides)

  • Transcriptomic and proteomic analysis:

    • Compare expression profiles under stress conditions

    • Implement ribosome profiling to assess translational responses

    • Apply phosphoproteomics to map stress-induced signaling changes

  • Membrane integrity assays:

    • Measure membrane permeability using fluorescent dyes

    • Assess membrane potential changes using voltage-sensitive probes

    • Analyze lipid composition alterations using lipidomics

  • Protein-protein interaction dynamics:

    • Investigate stress-induced changes in interaction networks

    • Apply BioID or APEX proximity labeling under stress conditions

    • Use FRET-based biosensors to track real-time interaction changes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.