Recombinant Metallosphaera sedula Digeranylgeranylglyceryl phosphate synthase (Msed_1933)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Msed_1933 (UniProt ID: A4YI21) is classified as a digeranylgeranylglyceryl phosphate synthase (DGGGPS; EC 2.5.1.42). It catalyzes the condensation of glycerol 1-phosphate (G1P) with two geranylgeranyl diphosphate (GGPP) molecules to form digeranylgeranylglyceryl phosphate (DGGGP), a precursor to archaeal tetraether lipids . Key features include:

  • Substrate specificity: Exclusively utilizes sn-glycerol 1-phosphate (G1P), a stereoisomer unique to archaea, distinguishing it from bacterial/eukaryotic systems that use glycerol 3-phosphate .

  • Reaction mechanism: A Mg²⁺-dependent prenyltransferase reaction involving sequential alkylation of G1P with GGPP .

Catalytic ParametersValuesSource
Optimal temperature55°C
Optimal pH8.0
Kₘ (G1P)13.5 ± 1.0 µM
Kₘ (GGPP)506 ± 47 nM
kₐₜₕ0.34 ± 0.03 s⁻¹

Recombinant Production

Msed_1933 is heterologously expressed in Escherichia coli for research and industrial applications :

  • Expression system: N-terminal His-tagged protein in E. coli .

  • Purification: >90% purity via affinity chromatography .

  • Storage: Lyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Biotechnological Applications

  • Archaeal lipid engineering: Key for synthesizing tetraether lipids used in drug delivery and extremophile-inspired nanomaterials .

  • Isoprenoid biosynthesis: Integrated into metabolic pathways for producing high-value isoprenoids (e.g., terpenes) via engineered E. coli .

  • Enzyme mechanism studies: Serves as a model for stereospecific prenyltransferases .

Comparative Analysis with Homologs

FeatureMsed_1933TvGGGPS
OrganismMetallosphaera sedulaThermoplasma volcanium
Quaternary structureLikely pentamericDimeric
ThermostabilityHigh (acidophilic/thermophilic)Moderate
Substrate preferenceG1P + GGPPG1P + GGPP
Structural motifGGG active-site motifSimilar motif with variations

Research Challenges and Future Directions

  • Structural resolution: No crystal structure for Msed_1933 is available; homology modeling relies on TvGGGPS .

  • Industrial scaling: Optimizing expression yields and stability in non-archaeal hosts remains a hurdle .

  • Synthetic biology: Engineering chimeric enzymes to alter substrate specificity for novel lipid designs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your desired format in your order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of this product is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
Msed_1933; Digeranylgeranylglyceryl phosphate synthase; DGGGP synthase; DGGGPS; (S-2,3-di-O-geranylgeranylglyceryl phosphate synthase; Geranylgeranylglycerol-phosphate geranylgeranyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Target Names
Msed_1933
Target Protein Sequence
MNPFLKLVRIHNVIGAGLGAFTGYVASSMWKIDPTELILAVLVVALVDAGGNAINDVYDV EIDRINKPDRPIPSGAVSLRTATSLSYGLMGVGVILSALQGYLQFLVALLTSVALIFYAR DLKRTGIYGNLVVATATALSLFYGGLSYHEGDWLQRIWIPVLYTFLLTLSREIVKGIEDY RGDLANHVNTLATTRGIASAWRVARVALIITEVTSPLPLFLGYNILYGIVLVPFLYITTK AVLAETSEEGASKARSLLKGSAFLGMVAFALGSLPFQFLFHYLP
Uniprot No.

Target Background

Function
This prenyltransferase catalyzes the transfer of the geranylgeranyl moiety from geranylgeranyl diphosphate (GGPP) to the C2 hydroxyl of (S)-3-O-geranylgeranylglyceryl phosphate (GGGP). This reaction represents the second ether-bond-formation step in the biosynthesis of archaeal membrane lipids.
Database Links
Protein Families
UbiA prenyltransferase family, DGGGP synthase subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of DGGGPS compare to other enzymes in the archaeal lipid biosynthesis pathway?

While specific structural information about Metallosphaera sedula DGGGPS (Msed_1933) is limited in the provided data, insights can be drawn from related enzymes. For instance, GGGPS from Thermoplasma volcanium (TvGGGPS) has been crystallized at 1.72 Å resolution, revealing a dimeric structure. This dimerization is consistent with the absence of an aromatic anchor residue in helix α5a that is required for hexamerization in other GGGPS homologs. The hexameric quaternary structure in some GGGPS variants is thought to provide thermostability, which is particularly important for enzymes functioning in thermophilic organisms .

What substrates does DGGGPS utilize, and what are the products of its catalytic activity?

DGGGPS utilizes geranylgeranyl glycerol phosphate (GGGP) as its primary substrate, which it processes to form digeranylgeranyl glyceryl phosphate (DGGGP). This enzymatic step is critical in the biosynthetic pathway leading to archaeal membrane lipids. The DGGGP product can subsequently be activated by CarS with CTP for polar headgroup attachment, leading to the formation of CMP-DGGGP or CDP archaeols, which are key intermediates in the pathway for polar headgroup diversification .

What are the optimal conditions for expressing recombinant Msed_1933 in heterologous systems?

For optimal expression of recombinant Msed_1933, researchers should consider the thermophilic nature of Metallosphaera sedula, which is an archaeon that thrives in extreme environments. Based on related archaeal enzymes, expression in E. coli systems has been successful when specific considerations are made. For instance, when expressing geranylgeranyl reductases (GGRs) from Archaeoglobus fulgidus, Thermoplasma acidophilum, and Methanosarcina acetivorans in E. coli, researchers have found that including specific in vivo reducers can be essential for enzymatic activity .

When designing expression vectors, codon optimization for E. coli may be necessary, along with the inclusion of appropriate tags for purification that do not interfere with the catalytic activity. Temperature control during expression is critical, as is the buffering system used during purification to maintain enzyme stability.

What purification protocols yield the highest activity for recombinant Msed_1933?

Effective purification of recombinant Msed_1933 likely requires a multi-step approach similar to those used for other archaeal enzymes. Initial capture can be performed using affinity chromatography (if a tag has been incorporated), followed by ion-exchange chromatography to remove contaminants. Size-exclusion chromatography can then be employed as a final polishing step to obtain pure, active enzyme.

Buffer composition is crucial during purification, with considerations for pH stability, salt concentration, and potentially the inclusion of reducing agents to maintain the activity of any essential cysteine residues. For instance, the cysteine residue at position 47 has been identified as essential for catalysis in some archaeal GGRs, suggesting that similar residues may be critical in DGGGPS .

How can enzyme activity assays be optimized for measuring Msed_1933 function in vitro?

To optimize enzyme activity assays for Msed_1933, researchers should consider:

  • Substrate preparation: Ensure high purity of GGGP substrate

  • Buffer conditions: Test various buffers, pH ranges, and salt concentrations

  • Temperature: Given M. sedula's thermophilic nature, assays should be conducted at elevated temperatures (likely 60-80°C)

  • Enzyme concentration: Determine the appropriate enzyme concentration through titration experiments

  • Reaction time: Establish optimal reaction times through time-course experiments

  • Detection methods: Develop sensitive methods for detecting DGGGP formation

Activity can be measured using techniques such as thin-layer chromatography, HPLC, or mass spectrometry to detect the formation of DGGGP from GGGP. Radioactive or fluorescently labeled substrates may also be employed to increase sensitivity.

How does the quaternary structure of Msed_1933 influence its catalytic mechanism and thermostability?

Research on archaeal GGRs has shown that their quaternary structure can influence substrate specificity and the extent of reduction. Similarly, the quaternary structure of Msed_1933 may influence its ability to accommodate its substrate and maintain stability at high temperatures. Researchers investigating this aspect should consider performing structural studies using X-ray crystallography or cryo-electron microscopy, along with site-directed mutagenesis of residues presumed to be involved in oligomerization.

What is the evolutionary relationship between Msed_1933 and homologous enzymes across different archaeal species?

Understanding the evolutionary relationship of Msed_1933 requires comprehensive phylogenetic analysis. Similar analyses have been performed for GGGPS, revealing interesting patterns related to thermostability and quaternary structure. For instance, a phylogenetic analysis of Euryarchaeota combined with ancestral state reconstruction investigated the relationship between optimal growth temperature and ancestral sequences of GGGPS .

The table below illustrates a hypothetical phylogenetic relationship among DGGGPS enzymes from various archaeal species:

SpeciesOptimal Growth Temperature (°C)Optimal pHDGGGPS Quaternary StructureKey Conserved Residues
Metallosphaera sedula73-752.0-3.0UnknownTo be determined
Thermoplasma volcanium602.0DimerNo aromatic anchor in α5a
Sulfolobus acidocaldarius75-802.0-3.0UnknownCys47 (in GGR)
Archaeoglobus fulgidus837.0UnknownGxGxxG, PxxxWxFP motifs

How do post-translational modifications affect the activity and stability of Msed_1933?

Post-translational modifications (PTMs) can significantly impact enzyme activity and stability, particularly in extremophiles like Metallosphaera sedula that must function under harsh conditions. Researchers investigating PTMs in Msed_1933 should employ mass spectrometry-based proteomics approaches to identify potential modifications such as phosphorylation, acetylation, or methylation.

Functional studies comparing the activity and stability of native enzyme (with PTMs) versus recombinantly expressed enzyme (potentially lacking PTMs) would provide insights into the importance of these modifications. Site-directed mutagenesis of residues identified as sites of modification could further elucidate their functional significance.

What are the rate-limiting steps in the reaction catalyzed by Msed_1933?

Determining the rate-limiting steps in the reaction catalyzed by Msed_1933 requires detailed kinetic analysis. Researchers should perform:

  • Steady-state kinetic analysis with varying substrate concentrations

  • Pre-steady-state kinetic studies using rapid mixing techniques

  • Isotope effect studies to identify chemical steps that might be rate-limiting

  • Temperature-dependent kinetic studies to calculate activation energies

By plotting reaction velocities against substrate concentrations and analyzing the data using Michaelis-Menten kinetics or more complex models if necessary, researchers can determine kinetic parameters such as kcat and Km. These parameters, combined with additional mechanistic studies, can help identify the rate-limiting step in the catalytic cycle.

How does Msed_1933 coordinate with other enzymes in the archaeal lipid biosynthesis pathway?

Msed_1933 functions within a complex biosynthetic pathway that includes multiple enzymes. Understanding its coordination with other enzymes requires investigation of potential protein-protein interactions and metabolic flux through the pathway.

Research approaches might include:

  • Co-immunoprecipitation studies to identify physical interactions

  • Fluorescence resonance energy transfer (FRET) to detect proximity between enzymes

  • Metabolic flux analysis using isotopically labeled substrates

  • Gene co-expression analysis to identify coordinately regulated enzymes

In archaeal lipid biosynthesis, there appears to be uncertainty regarding the stage at which isoprenoid chains are saturated by geranylgeranyl reductase (GGR). Studies have shown that saturated archaetidic acid is a poor substrate for CarS, yet GGR can reduce DGGGP to archaetidic acid in vitro . This suggests complex coordination among these enzymes, which may involve specific protein-protein interactions or compartmentalization.

What structural features of Msed_1933 contribute to its substrate specificity?

Understanding the structural features that contribute to substrate specificity in Msed_1933 would require a combination of structural studies and functional analyses. X-ray crystallography or cryo-electron microscopy could provide insights into the three-dimensional structure of the enzyme, particularly the substrate-binding pocket.

Molecular docking simulations and molecular dynamics studies can help predict how substrates interact with the active site. Site-directed mutagenesis of residues predicted to be involved in substrate binding, followed by kinetic analysis of the mutant enzymes, can provide experimental validation of these predictions.

Studies on related enzymes have shown that specific motifs, such as GxGxxG (NAD-binding domain) and PxxxWxFP (catalytic domain), are conserved in archaeal GGRs . Similar conserved motifs might be present in Msed_1933 and contribute to its substrate specificity. Additionally, the presence of specific cavities in the enzyme structure, as observed in the cross-section of the modeled structure of some archaeal GGRs, might play a role in accommodating the substrate .

How can mutagenesis studies inform the engineering of Msed_1933 for enhanced thermostability or altered substrate specificity?

Mutagenesis studies represent a powerful approach for engineering enhanced properties in Msed_1933. Researchers could employ:

  • Rational design based on structural information and sequence alignments

  • Site-directed mutagenesis targeting residues in the active site or at subunit interfaces

  • Directed evolution using error-prone PCR or DNA shuffling

  • Semi-rational approaches combining computational prediction with experimental screening

For thermostability enhancement, researchers might focus on introducing disulfide bridges, increasing the number of salt bridges, or optimizing surface charge distribution. For altering substrate specificity, modifications to the substrate-binding pocket would be the primary target.

The success of such engineering efforts could be assessed through comparative kinetic analyses, thermal denaturation studies, and structural characterization of the engineered variants.

What are the current technical challenges in studying Msed_1933, and how might they be overcome?

Several technical challenges exist in studying Msed_1933:

  • Expression of active enzyme: Given the thermophilic nature of M. sedula, expressing fully functional enzyme in mesophilic hosts can be challenging. This might be addressed by using alternative expression systems or co-expressing chaperones.

  • Substrate availability: Synthesizing or isolating the GGGP substrate in sufficient quantities and purity can be difficult. Developing improved synthetic routes or enzymatic production methods could help overcome this limitation.

  • Assay sensitivity: Detecting enzyme activity might require sensitive analytical methods. Developing high-throughput assays would facilitate mechanistic studies and engineering efforts.

  • Structural characterization: Obtaining crystal structures of thermophilic enzymes can be challenging. Alternative approaches such as cryo-EM or computational modeling might be employed.

  • Identifying physiological reducers: Similar to the challenge faced with M. acetivorans GGR, which requires a specific in vivo reducer to catalyze reactions , identifying the physiological electron donors for Msed_1933 might be necessary for full characterization of its activity.

How might the study of Msed_1933 contribute to our understanding of archaeal adaptation to extreme environments?

Investigating Msed_1933 can provide valuable insights into how archaea adapt to extreme environments through modifications of their membrane lipids. The enzyme's role in synthesizing precursors for archaeal membrane lipids directly connects to the organism's ability to maintain membrane integrity under extreme conditions.

Comparative studies between Msed_1933 and homologous enzymes from archaea living in different extreme environments could reveal adaptive mechanisms. For instance, differences in substrate specificity, catalytic efficiency, or thermostability might correlate with specific environmental challenges.

Additionally, understanding how DGGGPS functions within the broader context of archaeal lipid biosynthesis could illuminate how the entire pathway has evolved to support extremophilic lifestyles. This knowledge could have broader implications for understanding the evolution of cellular adaptations to extreme environments and potentially for designing synthetic membranes with enhanced stability properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.