Recombinant Metarhizium acridum Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Metarhizium acridum Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

Recombinant Metarhizium acridum Signal peptidase complex catalytic subunit SEC11 (SEC11) is a recombinant protein derived from the fungus Metarhizium acridum. This protein is part of the signal peptidase complex, which plays a crucial role in the processing of secretory proteins by removing signal peptides, allowing these proteins to be correctly targeted to their destinations within or outside the cell.

Function and Importance of Signal Peptidase Complex

The signal peptidase complex is essential for the maturation of proteins destined for secretion or membrane insertion. It cleaves the signal peptide from the precursor protein, facilitating its proper localization and function. In fungi like Metarhizium acridum, this process is vital for pathogenicity and stress tolerance, as many secreted proteins are involved in host-pathogen interactions and survival under adverse conditions.

Characteristics of Recombinant SEC11

  • Source: The recombinant SEC11 protein is derived from Metarhizium acridum, a fungus used as a biological control agent against insects.

  • Expression System: Typically, recombinant proteins like SEC11 are expressed in heterologous systems such as Escherichia coli or other suitable hosts to facilitate large-scale production.

  • Purification: The protein is often purified using affinity tags like His-tags to ensure high purity for research or application purposes.

  • Price and Availability: As of recent data, the recombinant SEC11 protein is available from suppliers like MyBioSource.com, with a listed price of $1,450.00 .

Data Table: Characteristics of Recombinant SEC11

CharacteristicsDescription
SourceMetarhizium acridum
Expression SystemTypically E. coli
Purification MethodAffinity tags (e.g., His-tag)
Price$1,450.00 (MyBioSource.com)
FunctionSignal peptide cleavage for protein maturation

References MyBioSource.com. Recombinant Metarhizium acridum Signal peptidase complex catalytic subunit SEC11 (SEC11). MDPI. MaNrtB, a Putative Nitrate Transporter, Contributes to Stress Tolerance in Metarhizium acridum. PMC. MaAzaR Influences Virulence of Metarhizium acridum against Locusta migratoria manilensis. PMC. MaPac2, a Transcriptional Regulator, Is Involved in Conidiation and Pathogenicity of Metarhizium acridum.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC11; MAC_05744; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Metarhizium acridum (strain CQMa 102)
Target Names
SEC11
Target Protein Sequence
MLSGLQNPRQAAAQLMNFALILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNMWQETAVGEIVVYNVKGKDIPIVHRVVRKFGTGDKAKLLTKGDNNNADDTDLYA RGQDYLERKDIIGSVVAYFPFVGYVTILLSEHPWLKTVMLGIMGLLVVIQRE
Uniprot No.

Target Background

Function
The Recombinant *Metarhizium acridum* Signal peptidase complex catalytic subunit SEC11 (SEC11) is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs during protein translocation—either co-translationally or post-translationally—through the translocon pore into the endoplasmic reticulum.
Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Metarhizium acridum and what ecological significance does it have?

Metarhizium acridum (formerly classified as Metarhizium anisopliae var. acridum) is an entomopathogenic fungus that occurs naturally in soils worldwide and is primarily used as a biological control agent against locusts and grasshoppers. The fungus is effective against multiple species including the Italian locust (Calliptamus italicus), Asian migratory locust (Locusta migratoria), Moroccan locust (Dociostaurus maroccanus), and Desert locust (Schistocerca gregaria), among others . Its mode of action involves germination on the insect's cuticle followed by penetration through a combination of physical pressure and enzymatic activity. As the fungus develops, it competes with the host insect for essential resources such as water and nutrients . Experimental data has demonstrated mortality rates of approximately 90% in target species, making it a highly effective biopesticide alternative to chemical insecticides for sustainable agriculture and ecosystem management.

What is the fundamental role of SEC11 in protein processing?

SEC11 functions as a catalytic subunit of the signal peptidase complex (SPC), which is responsible for cleaving signal peptides from newly synthesized proteins during their translocation into the endoplasmic reticulum or other cellular compartments. Based on homology studies with other organisms, the SEC11 protein in Metarhizium acridum likely plays a critical role in the processing of secreted proteins, including virulence factors and enzymes involved in host invasion. In Saccharomyces cerevisiae, the SEC11 homolog is essential for signal peptide processing and cell growth , suggesting similar critical functions in M. acridum. The signal peptidase complex typically contains multiple subunits, with SEC11 serving as one of the primary catalytic components that directly performs the proteolytic cleavage of signal peptides from precursor proteins, thereby enabling proper protein localization and function within the cell.

How is SEC11 structurally and functionally conserved across fungal species?

SEC11 represents a highly conserved protein across fungal species, sharing significant structural and functional similarities with homologs in other organisms. Research on signal peptidases in yeast has shown that the protease complex contains catalytic subunits that are related to the family of eubacterial and eukaryotic signal peptidases . These enzymes share conserved domains and catalytic residues that are essential for their proteolytic activity. In Saccharomyces cerevisiae, the inner membrane protease contains two catalytic subunits, Imp1p and Imp2p, which have separate, non-overlapping substrate specificities . The functional conservation of SEC11 across species suggests that the Metarhizium acridum variant likely maintains the core catalytic mechanism while potentially exhibiting species-specific substrate preferences that may be related to its lifestyle as an entomopathogenic fungus.

How does temperature affect SEC11 activity and what are the implications for experimental design?

When designing experiments involving recombinant M. acridum SEC11, researchers should consider the following temperature-related factors:

Temperature Range (°C)Expected Effect on SEC11 ActivityExperimental Considerations
Below 20Reduced enzymatic activityLonger incubation times required; potential conformational changes affecting substrate binding
20-30Moderate to optimal activitySuitable for most standard assays; representative of many natural environments
30-38Optimal activity rangeIdeal for maximum enzymatic throughput; may not reflect all ecological conditions
Above 38Declining activity due to potential denaturationRisk of protein instability; avoid unless studying thermal tolerance

Field observations indicate that Metarhizium performance is likely to be insufficient when environmental conditions include hot days (>38°C) and cool nights (<20°C), suggesting that SEC11 and other enzymes may have reduced functionality under these fluctuating temperature regimes . This thermal sensitivity should be carefully considered when planning both laboratory experiments and field applications.

How does the catalytic mechanism of SEC11 function in relation to host invasion?

The catalytic mechanism of SEC11 in Metarhizium acridum plays an indirect but critical role in host invasion by ensuring proper processing of secreted virulence factors. As a signal peptidase, SEC11 cleaves signal sequences from preproteins during their translocation across membranes, which is essential for the maturation and functional activation of many secreted proteins. The fungus germinates on the insect's cuticle and penetrates through a combination of physical pressure and enzymatic activity , with the latter requiring properly processed enzymes.

Based on studies of signal peptidases in other organisms, SEC11 likely employs a serine-lysine catalytic dyad mechanism for peptide bond hydrolysis. This process involves:

  • Recognition of the signal peptide-mature protein junction

  • Positioning of the scissile bond in the active site

  • Nucleophilic attack by the catalytic serine residue

  • Formation of a tetrahedral intermediate

  • Resolution of the intermediate and release of the cleaved signal peptide

The efficiency of this catalytic process directly impacts the fungus's ability to secrete the enzymes necessary for degrading the insect cuticle, which is composed primarily of chitin and proteins. Without functional SEC11, the fungus would be unable to properly process and secrete these essential virulence factors, significantly impairing its pathogenicity and ability to invade host tissues.

What are the optimal conditions for expressing recombinant Metarhizium acridum SEC11?

Expressing recombinant Metarhizium acridum SEC11 requires careful optimization of expression systems and conditions to ensure proper folding and activity of this membrane-associated protein. Based on studies of similar signal peptidase subunits, the following expression strategy is recommended:

Expression System Selection:
SEC11 is an integral membrane protein as evidenced by studies of its homologs in other systems, such as the canine signal peptidase complex subunits that demonstrate resistance to alkaline extraction . For such membrane proteins, the following expression systems should be considered:

Expression SystemAdvantagesDisadvantagesOptimal for SEC11?
E. coliCost-effective, high yield, well-established protocolsMay not provide proper folding of eukaryotic membrane proteinsMay require fusion partners and solubilization tags
Yeast (P. pastoris or S. cerevisiae)Post-translational modifications, membrane protein machineryLonger expression time, more complex mediaRecommended primary choice due to evolutionary proximity
Insect cells (Sf9, Sf21)Superior folding of complex eukaryotic proteinsHigher cost, specialized equipment, slower growthExcellent alternative if yeast expression fails
Mammalian cellsMost authentic post-translational processingHighest cost, lowest yield, technically demandingNot recommended unless specific modifications are essential

Expression Conditions:
For yeast-based expression, which offers the best balance of authenticity and yield for fungal membrane proteins, the following conditions are recommended:

  • Use inducible promoters (e.g., methanol-inducible AOX1 for P. pastoris)

  • Maintain cultures at 25-28°C during induction phase

  • Include low concentrations (0.5-2%) of membrane-mimetic detergents during cell lysis

  • Extract with non-ionic detergents such as n-dodecyl β-D-maltoside (DDM) or digitonin

  • Purify using immobilized metal affinity chromatography (IMAC) with histidine tags positioned on the C-terminus

These conditions maximize the likelihood of obtaining correctly folded, active SEC11 protein suitable for subsequent biochemical and structural studies.

How can researchers purify SEC11 while maintaining its catalytic activity?

Purifying the Metarhizium acridum SEC11 while preserving its catalytic activity presents several challenges due to its membrane-associated nature. Studies on signal peptidase complex (SPC) subunits from other organisms indicate that these proteins typically exist in complexes rather than as monomers in their native state . Therefore, a carefully designed purification strategy is essential:

Step-by-Step Purification Protocol:

  • Membrane Fraction Isolation

    • Lyse cells under gentle conditions (e.g., enzymatic lysis with lysozyme for bacterial cells, or mechanical disruption for yeast)

    • Separate membrane fractions by ultracentrifugation (100,000 × g for 1 hour)

    • Wash membrane pellet with high salt buffer (300-500 mM NaCl) to remove peripheral proteins

  • Detergent Solubilization

    • Resuspend membrane pellet in buffer containing mild non-ionic detergents (DDM 1-2% or digitonin 0.5-1%)

    • Avoid solubilization at alkaline pH, as this has been shown to cause partial dissociation of signal peptidase complexes

    • Incubate with gentle rotation at 4°C for 1-2 hours

  • Affinity Chromatography

    • Apply solubilized material to appropriate affinity resin (IMAC for His-tagged constructs)

    • Include low concentrations of detergent (0.05-0.1% DDM) in all chromatography buffers

    • Elute using imidazole gradient or specific elution conditions for the chosen affinity tag

  • Size Exclusion Chromatography

    • Apply concentrated affinity-purified sample to a size exclusion column

    • Monitor elution profile to determine whether SEC11 exists primarily in complex with other proteins or as a monomer

    • Collect fractions and assay for signal peptidase activity

It's important to note that evidence from studies on canine signal peptidase complex indicates that no steady-state pool of monomeric Sec11p-like proteins is detected in microsomal membranes, and Sec11p-like subunits displaced from the complex demonstrate no signal peptide processing activity by themselves . Therefore, researchers should consider whether to pursue purification of SEC11 alone or aim to isolate the intact signal peptidase complex from M. acridum for functional studies.

What assays can be used to measure SEC11 enzymatic activity?

Assessing the enzymatic activity of recombinant Metarhizium acridum SEC11 requires specialized assays that measure its signal peptidase function. The following methodologies are recommended based on established approaches for characterizing signal peptidases:

In Vitro Cleavage Assays:

  • Fluorogenic Peptide Substrates

    • Design synthetic peptides containing the predicted signal peptide cleavage site flanked by a fluorophore and quencher

    • Upon cleavage by active SEC11, the fluorophore and quencher separate, resulting in measurable fluorescence

    • Advantages: Quantitative, real-time monitoring, high sensitivity

    • Limitations: Requires knowledge of preferred cleavage sites

  • Radiolabeled Substrate Cleavage

    • Generate ^35S-labeled preprotein substrates by in vitro translation

    • Incubate with purified SEC11 or signal peptidase complex

    • Analyze cleavage products by SDS-PAGE and autoradiography

    • Advantages: Works with full-length protein substrates, high sensitivity

    • Limitations: Requires radioisotope handling facilities, not real-time

  • Mass Spectrometry-Based Assays

    • Incubate unlabeled peptide or protein substrates with SEC11

    • Analyze reaction products by LC-MS/MS to identify precise cleavage sites

    • Advantages: Provides exact cleavage site information, no labels required

    • Limitations: Lower throughput, requires specialized equipment

Activity Measurement Parameters:

ParameterRecommended RangeNotes
pH6.5-8.0Optimal pH typically around 7.2-7.5
Temperature25-30°CMay vary based on the natural habitat of M. acridum
Divalent cations2-5 mM Mg^2+ or Ca^2+Some signal peptidases show metal ion dependence
Detergent0.01-0.1% DDM or digitoninNecessary to maintain protein solubility
Reaction time15-60 minutesLonger for complex protein substrates

It's important to note that, similar to findings with canine signal peptidase complex components, SEC11 may not demonstrate activity as an isolated subunit, as studies have shown that Sec11p-like subunits displaced from their complexes demonstrate no signal peptide processing activity by themselves . Therefore, researchers should consider reconstitution approaches that combine SEC11 with other signal peptidase complex components to restore functional activity.

How should researchers design experiments to compare SEC11 function across different fungal species?

Comparative analysis of SEC11 function across different fungal species requires a systematic approach that accounts for both sequence conservation and potential functional divergence. When designing such comparative experiments, researchers should consider:

Phylogenetic Analysis Framework:
First, establish the evolutionary relationships between SEC11 proteins from different species to provide context for functional comparisons. This should include:

  • Multiple sequence alignment of SEC11 homologs from diverse fungi, including:

    • Entomopathogenic fungi (Metarhizium spp., Beauveria spp.)

    • Model yeasts (Saccharomyces cerevisiae, Schizosaccharomyces pombe)

    • Plant pathogens (Fusarium spp., Magnaporthe oryzae)

    • Human pathogens (Candida albicans, Aspergillus fumigatus)

  • Identification of conserved catalytic residues and domains, particularly those identified in well-characterized systems such as the yeast inner membrane protease with its catalytic subunits Imp1p and Imp2p .

Functional Complementation Strategy:
To directly compare functional conservation, design complementation experiments:

  • Generate SEC11 deletion mutants in a model fungus (e.g., S. cerevisiae)

  • Introduce SEC11 variants from different fungi, including M. acridum

  • Assess restoration of growth and protein processing

  • Quantify rescue efficiency as a measure of functional conservation

This approach leverages the essential nature of SEC11 in yeast, where it is required for signal peptide processing and cell growth , providing a robust readout of functional conservation.

Substrate Specificity Analysis:
To explore potential adaptive differences in SEC11 function:

  • Create a library of signal peptide-containing substrates from each fungal species

  • Test cross-processing capability of each SEC11 homolog against the substrate panel

  • Identify patterns of specificity that correlate with fungal lifestyle (e.g., entomopathogen vs. saprophyte)

This systematic approach will reveal whether SEC11 function has undergone adaptive evolution related to the specialized lifestyle of Metarhizium acridum as an entomopathogenic fungus.

What environmental factors should be controlled when studying SEC11 function in relation to Metarhizium acridum pathogenicity?

When investigating the relationship between SEC11 function and Metarhizium acridum pathogenicity, researchers must carefully control environmental variables that impact both enzyme activity and fungal virulence. Based on field studies of Metarhizium effectiveness, several critical environmental factors require precise control:

  • Maintain constant temperatures within the 25-30°C range for optimal enzyme function

  • If studying environmental adaptation, include controlled temperature cycling to mimic natural conditions

  • Monitor and record temperature throughout experimental duration

Humidity and Moisture:
Water availability impacts spore germination and fungal development on insect cuticles:

  • Maintain relative humidity at 60-80% for optimal fungal growth

  • Control moisture content of substrates when conducting in vitro experiments

  • Consider water activity (aw) rather than simple moisture content when comparing across substrates

Host Factors:
When studying pathogenicity, standardize insect host variables that might affect SEC11 function indirectly:

  • Use insects of consistent age and developmental stage (ideally 2nd to 4th instar for locust hoppers)

  • Control for host immune status and nutritional condition

  • Standardize cuticle composition by rearing hosts on defined diets

Vegetation and Habitat Factors:
For field or semi-field studies, habitat structure affects fungal-host interactions:

  • Areas with sparse and clumpy vegetation are suitable for trials

  • Avoid vegetation that is too dense (where the microbial insecticide becomes too diluted) or too light (where insect movement is excessive)

By systematically controlling these variables, researchers can more precisely determine the relationship between SEC11 function and pathogenicity, separating direct enzymatic effects from environmental influences on the host-pathogen interaction.

How can researchers troubleshoot expression and activity issues with recombinant SEC11?

Recombinant expression of membrane-associated proteins like SEC11 frequently presents challenges that require systematic troubleshooting. Based on experiences with similar signal peptidase complex components, the following diagnostic approach is recommended:

Expression Troubleshooting Decision Tree:

  • No detectable protein expression

    • Verify construct integrity by sequencing

    • Test alternative promoters (constitutive vs. inducible)

    • Optimize codon usage for expression host

    • Consider toxicity issues:

      • Switch to tightly regulated inducible systems

      • Use secretion tags to direct protein away from cytoplasm

      • Consider lower temperature expression (16-20°C)

  • Protein expressed but insoluble

    • Evidence from studies on canine signal peptidase complex subunits indicates that both the 18- and 21-kDa SPC subunits are integral membrane proteins , suggesting SEC11 may require special solubilization approaches:

      • Test different detergents (DDM, digitonin, CHAPS) at varying concentrations

      • Add stabilizing agents (glycerol 5-10%, specific lipids)

      • Try membrane-mimetic systems (nanodiscs, amphipols)

      • Consider fusion partners with solubility-enhancing properties

  • Protein soluble but inactive

    • Research indicates that no steady-state pool of Sec11p-like monomers exists in microsomal membranes, and Sec11p-like subunits displaced from the complex demonstrate no signal peptide processing activity by themselves . Therefore:

      • Co-express with other signal peptidase complex components

      • Attempt to isolate the native complex from M. acridum

      • Reconstruct minimal functional complexes by combining purified components

      • Verify proper folding using circular dichroism or limited proteolysis

Activity Restoration Strategies:

IssueDiagnostic ApproachRestoration Strategy
Improper foldingLimited proteolysis, CD spectroscopyRefold in presence of lipids/detergent mixtures
Missing cofactorsActivity assays with cofactor supplementationAdd divalent cations (Mg²⁺, Ca²⁺, Zn²⁺)
Subunit dissociationSize exclusion chromatographyReconstitute with other SPC components
Post-translational modificationsMass spectrometry analysisSwitch to expression system with appropriate modification capacity

Since alkaline extraction of microsomes prior to solubilization or solubilization at alkaline pH causes partial dissociation of the signal peptidase complex , researchers should take care to maintain physiological pH throughout purification procedures to preserve native protein interactions that may be essential for SEC11 activity.

How does SEC11 function in Metarhizium acridum contribute to its potential as a biological control agent?

SEC11 in Metarhizium acridum plays an integral role in the fungus's effectiveness as a biological control agent through its involvement in protein processing pathways that support pathogenicity. The connection between SEC11 function and biocontrol potential can be understood through several mechanisms:

Virulence Factor Processing:
As a catalytic subunit of the signal peptidase complex, SEC11 is responsible for processing secreted proteins, many of which are virulence factors essential for insect pathogenesis. Metarhizium acridum's infection process involves germination on the insect's cuticle followed by penetration through a combination of physical pressure and enzymatic activity . The enzymes involved in cuticle degradation must be properly processed by the signal peptidase complex to be secreted and functional.

Host Range Determination:
Metarhizium acridum demonstrates specificity for certain insect hosts, particularly locusts and grasshoppers . This host specificity may be partially determined by the substrate preferences of SEC11, which processes specific virulence factors adapted to these hosts. Understanding SEC11 function may provide insights into the molecular basis of host specificity and potentially allow for engineering enhanced strains with tailored host ranges.

Environmental Adaptation:
The effectiveness of Metarhizium as a biological control agent is significantly influenced by environmental conditions, particularly temperature . SEC11, as an enzyme, would have temperature-dependent activity profiles that contribute to the fungus's performance under varying field conditions. Characterizing these dependencies could help predict biocontrol efficacy across different environments and seasons.

Application Development:
Current formulations of Metarhizium acridum for locust control include products that are applied as pale green powders . Research on SEC11 function could inform improved production methods and formulations by ensuring optimal protein processing during manufacturing, potentially enhancing field efficacy and shelf life of commercial preparations.

By understanding the molecular mechanisms of SEC11 function in Metarhizium acridum, researchers can develop more effective biological control strategies that capitalize on the natural pathogenicity of this fungus while minimizing environmental impacts associated with chemical insecticides.

What techniques can be used to study the interaction between SEC11 and other components of the signal peptidase complex?

Investigating the interactions between SEC11 and other components of the signal peptidase complex in Metarhizium acridum requires specialized techniques for membrane protein complexes. Based on studies of similar complexes in other organisms, the following approaches are recommended:

Co-Immunoprecipitation (Co-IP) and Pull-down Assays:
Evidence from studies on canine signal peptidase complex indicates that upon detergent solubilization, both SEC11-like proteins are found in a complex with other SPC subunits . To identify similar interactions in M. acridum:

  • Generate antibodies against M. acridum SEC11 or use epitope-tagged versions

  • Solubilize membranes under non-denaturing conditions

  • Perform pull-downs to capture SEC11 and associated proteins

  • Identify co-precipitating proteins by mass spectrometry

This approach can reveal the composition of the native signal peptidase complex in M. acridum and identify potential regulatory partners.

Crosslinking Mass Spectrometry (XL-MS):
To map the spatial organization of the complex:

  • Treat intact membranes or purified complexes with chemical crosslinkers

  • Digest crosslinked samples and enrich for crosslinked peptides

  • Analyze by liquid chromatography-tandem mass spectrometry

  • Use specialized software to identify crosslinked residues

  • Generate spatial restraints for structural modeling

This technique provides valuable information about protein proximities within the native complex, helping to construct structural models.

Biophysical Interaction Analysis:
To quantify binding parameters between SEC11 and other components:

TechniqueApplicationAdvantagesLimitations
Surface Plasmon Resonance (SPR)Measure binding kineticsReal-time, label-freeRequires immobilization
Microscale Thermophoresis (MST)Determine binding affinitiesWorks in complex solutionsRequires fluorescent labeling
Analytical Ultracentrifugation (AUC)Characterize complex formationDirect observation of complexLow throughput

Genetic Interaction Mapping:
To understand functional relationships:

  • Generate conditional mutants or CRISPR interference constructs for SEC11 and candidate interacting partners

  • Perform synthetic genetic array analysis to identify genetic interactions

  • Map the functional interaction network of the signal peptidase complex

This genetic approach complements biochemical methods by revealing functional dependencies that may not be detected through physical interaction studies alone.

Research on similar systems has shown that alkaline extraction of microsomes prior to solubilization or solubilization at alkaline pH causes partial dissociation of the signal peptidase complex . Therefore, careful attention to buffer conditions is essential when studying these interactions to prevent artifactual disruption of physiologically relevant protein associations.

What are the most promising research directions for understanding SEC11 function in Metarhizium acridum?

The study of SEC11 in Metarhizium acridum presents several promising research avenues that could significantly advance our understanding of fungal protein processing and entomopathogenicity. Based on current knowledge gaps and technological capabilities, the following research directions hold particular promise:

Structural Biology Approaches:
Determining the three-dimensional structure of M. acridum SEC11, both alone and in complex with other signal peptidase components, would provide unprecedented insights into its catalytic mechanism. Recent advances in cryo-electron microscopy (cryo-EM) have made membrane protein complex structures more accessible, potentially allowing researchers to visualize the complete signal peptidase complex architecture. This structural information would facilitate structure-based drug design for novel antifungal compounds and enable protein engineering efforts to enhance SEC11 function.

Systems Biology Integration:
A comprehensive understanding of how SEC11 function integrates with broader cellular networks is essential. This includes:

  • Transcriptomics analysis to identify co-regulated genes during host infection

  • Proteomics studies to catalog all proteins processed by the signal peptidase complex

  • Metabolomics approaches to link protein processing to virulence factor production

  • Network modeling to predict system-wide effects of SEC11 modulation

Comparative Genomics and Evolution:
Leveraging the growing database of fungal genomes to explore how SEC11 has evolved across species with different lifestyles could reveal adaptive patterns related to host specialization. Of particular interest is comparing SEC11 sequences and predicted structures between generalist fungi and specialists like M. acridum that target specific insect hosts . This evolutionary perspective may uncover the molecular basis for host specificity and pathogenic potential.

Biotechnological Applications:
The central role of SEC11 in protein processing suggests several biotechnological applications:

  • Engineering SEC11 variants with enhanced activity or altered substrate specificity

  • Developing SEC11 inhibitors as potential antifungal agents

  • Optimizing SEC11 function for improved production of recombinant proteins

  • Enhancing Metarhizium strains for improved biocontrol efficacy through SEC11 modification

By pursuing these research directions, scientists can build a comprehensive understanding of SEC11 function in Metarhizium acridum and leverage this knowledge for both fundamental science and applied biotechnology.

How might advanced genetic tools be applied to study SEC11 function in Metarhizium acridum?

The application of cutting-edge genetic tools to study SEC11 function in Metarhizium acridum offers powerful approaches to understanding this protein's role in fungal biology and pathogenesis. The following methodologies represent the frontier of genetic manipulation for functional studies in filamentous fungi:

CRISPR-Cas9 Genome Editing:
CRISPR-Cas9 technology has revolutionized fungal genetics by enabling precise modifications to the genome. For SEC11 functional studies, the following applications are particularly valuable:

  • Targeted Gene Replacement: Generate complete SEC11 deletion mutants to assess essentiality and global impacts on the secretome.

  • Site-Directed Mutagenesis: Create point mutations in catalytic residues to dissect structure-function relationships.

  • Promoter Replacement: Substitute the native SEC11 promoter with inducible/repressible systems to create conditional mutants for essential genes.

  • Fluorescent Tagging: Insert fluorescent protein tags to track SEC11 localization and dynamics.

RNA Interference and Antisense Approaches:
For cases where complete gene deletion may be lethal, RNA interference provides an alternative for studying SEC11 function:

  • Hairpin RNA Constructs: Design constructs targeting SEC11 mRNA for degradation.

  • Inducible RNAi Systems: Develop systems allowing temporal control of SEC11 knockdown.

  • Tissue-Specific Promoters: Create constructs for stage-specific or tissue-specific SEC11 silencing during host invasion.

High-Throughput Phenotypic Screening:
To understand the functional consequences of SEC11 modification:

  • Mutant Libraries: Generate libraries of SEC11 variants with random or directed mutations.

  • Automated Phenotyping: Deploy high-content imaging to assess growth, morphology, and pathogenicity.

  • Miniaturized Bioassays: Develop micro-scale pathogenicity assays using insect cell cultures or tissue explants.

Heterologous Expression Systems:
For complementation and comparative studies:

  • Cross-Species Complementation: Express SEC11 from various fungal species in M. acridum SEC11 mutants.

  • Synthetic Biology Approaches: Construct minimal signal peptidase complexes with defined components.

  • Split-Protein Systems: Develop assays for protein-protein interactions using techniques like bimolecular fluorescence complementation.

These genetic approaches can be integrated with biochemical and structural methods to develop a comprehensive understanding of SEC11 function. The resulting insights would not only advance our understanding of fundamental fungal biology but could also inform the development of enhanced biocontrol strains with improved efficacy against target pests .

What interdisciplinary approaches might yield the most comprehensive understanding of SEC11 biology?

A truly comprehensive understanding of SEC11 biology in Metarhizium acridum requires the integration of multiple scientific disciplines, creating synergistic approaches that overcome the limitations of any single methodology. The following interdisciplinary framework represents an optimal strategy for elucidating SEC11 function:

Integrating Structural Biology with Computational Approaches:
Combining experimental structural determination with computational modeling provides powerful insights into protein function:

  • Hybrid Structure Determination: Integrate cryo-EM of the signal peptidase complex with X-ray crystallography of individual domains.

  • Molecular Dynamics Simulations: Model SEC11 dynamics within membrane environments to understand conformational changes during catalysis.

  • Machine Learning Approaches: Apply deep learning algorithms to predict substrate specificity from primary sequence data.

  • Quantum Mechanics/Molecular Mechanics (QM/MM): Model the reaction mechanism at the catalytic site with quantum-level precision.

Merging Molecular Biology with Systems-Level Analyses:
Connecting molecular mechanisms to cellular and organismal phenotypes:

  • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data to build comprehensive models of SEC11 function.

  • Network Analysis: Map the position of SEC11 within protein interaction networks and signaling pathways.

  • Flux Analysis: Quantify how SEC11 activity influences the rate of protein secretion during different growth phases and host invasion stages.

Bridging Laboratory and Field Studies:
Connecting molecular mechanisms to ecological function:

  • Controlled Environment Testing: Evaluate SEC11 variants under defined laboratory conditions that simulate natural environments.

  • Field Validation: Test predictions about SEC11 function in real-world applications of M. acridum as a biocontrol agent.

  • Ecological Modeling: Incorporate molecular data into models predicting biocontrol efficacy across diverse environments.

Cross-Kingdom Comparative Biology:
Leveraging evolutionary insights across diverse organisms:

KingdomRelevant SEC11 StudiesPotential Insights
FungiCompare SEC11 across pathogenic, symbiotic, and free-living fungiAdaptations for different lifestyles
BacteriaStudy bacterial type I signal peptidasesAncestral functions and core mechanisms
AnimalsExamine signal peptidase complex in insects (M. acridum hosts)Host-pathogen co-evolution
PlantsInvestigate plant signal peptidasesConvergent evolution of processing mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.