Recombinant Metarhizium robertsii High osmolarity signaling protein MOS1 (MOS1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
MOS1; SHO1; MAA_01571; High osmolarity signaling protein MOS1; Osmosensor MOS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23))
Target Names
MOS1
Target Protein Sequence
MEHSRPYGGRKRMSLGNILGDPFALATISISLLAWFITFISCVIAQVQANKNKGLPDKDN PDGNFPPFAWWAVVYSLFLIVGVVIVVASDAIQTYHVAVTGYLAGGMVLVTSGVNSLVYS KNGAREAAAAGFILLSMVVIVWIFYFGSTPSSTPRAFLDSFALSKDSGAMHNQAMNGYGG TGRPETSNSVQPPQMYTSAQLNGFENPSPVGGASQAPTAPTMPTYGNNTMQPNNKSNDEE VLPPIDYPYQAKAIYSYEANPSDANEISFSKHEILDVSDVSGRWWQARRRGTNEIGIAPS NYLILL
Uniprot No.

Target Background

Function
A plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity. It plays a role in fungal virulence.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MOS1 and what is its functional role in Metarhizium robertsii?

MOS1 (Metarhizium Osmosensor-like protein) is a membrane-bound osmosensor that mediates cellular responses to high osmotic pressure in Metarhizium robertsii. This protein is critical for the fungus's adaptation when transitioning from the insect cuticle to the hemolymph environment, which has significantly higher osmotic pressure .

MOS1 contains four transmembrane regions and a C-terminal Src homology 3 (SH3) domain (residues 262-317), making it structurally similar to the Saccharomyces cerevisiae osmosensor SHO1 . The protein functions as a sensory component that detects osmotic stress and triggers appropriate cellular responses, including gene expression changes related to hyphal body formation, cell membrane stiffness, and generation of intracellular turgor pressure .

How is MOS1 gene expression regulated during the infection process?

MOS1 expression follows a specific pattern during the infection cycle:

  • Low-level expression is maintained in the absence of hyperosmotic stress, providing baseline surveillance of osmotic conditions

  • Significant upregulation occurs when the fungus encounters high osmotic environments, such as insect hemolymph or high-osmolarity artificial media

  • Expression patterns reflect the need for increased sensitivity and signaling capacity during prolonged osmotic stress

Research has demonstrated that MOS1 transcript levels increase by approximately 80% in high-osmolarity conditions compared to normal growth conditions, suggesting tight transcriptional regulation based on environmental cues .

What phenotypic changes occur in MOS1-deficient mutants?

When MOS1 is knocked down or deleted, several phenotypic changes are observed:

  • Increased sensitivity to osmotic stress (demonstrated by growth delays in media with increasing KCl concentrations)

  • Reduced resistance to oxidative stress

  • Impaired developmental processes, including appressorium and hyphal body formation

  • Significantly reduced virulence in insect bioassays

  • Increased sensitivity to high salt stress, although MOS1 expression is not directly induced by salt stress

These phenotypic alterations confirm MOS1's role in stress adaptation and pathogenicity, making it a crucial protein for the fungus's lifecycle.

How does MOS1 mediate signal transduction during osmotic stress?

MOS1 functions as part of a complex signaling cascade that resembles the HOG (High Osmolarity Glycerol) pathway described in yeast. Current research suggests this signaling mechanism involves:

  • Initial sensing: MOS1's transmembrane domains detect changes in membrane tension due to osmotic stress

  • SH3 domain interactions: The C-terminal SH3 domain initiates protein-protein interactions with downstream effectors

  • MAPK cascade activation: Signal transduction likely proceeds through a MAP kinase cascade similar to the yeast HOG pathway

  • Transcriptional reprogramming: Activation leads to changes in gene expression patterns controlling:

    • Cell wall composition

    • Osmolyte production (particularly glycerol)

    • Stress response proteins

    • Developmental transitions

The signaling pathway appears to involve negative feedback mechanisms, as observed in yeast where HOG1 inhibits SHO1 to limit cellular responses to osmotic stress stimuli .

What are the molecular methods for studying MOS1 function?

Several experimental approaches have proven effective for investigating MOS1 function:

Gene Manipulation Techniques:

  • RNA interference using antisense vectors (reducing transcript levels by ~80%)

  • Complete gene deletion using dominant selectable markers (e.g., bar gene)

  • Complementation with wild-type genes to confirm phenotype restoration

Expression Analysis:

  • qRT-PCR to monitor transcript levels under different conditions

  • RNA-seq to identify downstream genes regulated by MOS1

Protein Characterization:

  • Recombinant protein production for structural and functional studies

  • Hydrophobicity profile analysis for transmembrane region identification

  • Phylogenetic analysis to identify homologs in related species

Functional Assays:

  • Growth assays on media with various osmotic agents (KCl, NaCl, sorbitol)

  • Stress tolerance tests (oxidative, cell wall stress)

  • Insect bioassays using topical application and direct injection methods

How can recombinant MOS1 be efficiently produced and purified?

The production of functional recombinant MOS1 presents several challenges due to its membrane-bound nature. Based on current protocols, the following approach is recommended:

  • Expression System Selection:

    • E. coli systems for basic structural studies

    • Yeast expression systems (P. pastoris or S. cerevisiae) for functional studies, as they provide proper membrane insertion and post-translational modifications

  • Construct Design:

    • Full-length protein (amino acids 1-306)

    • Consider fusion tags (His, GST) for purification, but verify they don't disrupt function

    • Codon optimization for the selected expression host

  • Purification Strategy:

    • Membrane fractionation

    • Detergent solubilization (mild non-ionic detergents like DDM or CHAPS)

    • Affinity chromatography

    • Size exclusion chromatography for final polishing

  • Storage Conditions:

    • Tris-based buffer with 50% glycerol at -20°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

The successful production of recombinant MOS1 enables various downstream applications, including structural studies, protein-protein interaction analyses, and the development of inhibitors for potential agricultural applications.

How does MOS1 compare evolutionarily with osmosensors in other fungi?

MOS1 represents an evolutionarily conserved protein family present across the fungal kingdom:

SpeciesProteinIdentity to MrMOS1Key Features
Metarhizium robertsiiMOS1100%4 transmembrane domains, C-terminal SH3 domain
Saccharomyces cerevisiaeSHO134.1%Similar hydrophobicity profile, conserved SH3 domain
Candida albicansSHO131.5%Similar membrane topology
Other Metarhizium speciesMOS1 homologsVariedPresent in M. anisopliae, M. majus, M. brunneum, but absent in M. album and M. acridum (narrow host range species)

Phylogenetic analysis indicates that MOS1 homologs are widely distributed among fungi and follow an evolutionary history that parallels fungal speciation . The most highly conserved region across species is the SH3 domain, suggesting its critical functional importance .

The differential presence of MOS1 in various Metarhizium species correlates with host range breadth, suggesting that MOS1 acquisition may have contributed to expanded host ranges in certain lineages .

What is the relationship between MOS1 and other virulence factors in M. robertsii?

MOS1 functions as part of a complex network of virulence factors in M. robertsii:

  • Integration with Cell Wall Integrity Pathways:

    • MOS1 mutants show increased sensitivity to cell wall-disturbing agents, suggesting crosstalk between osmosensing and cell wall integrity pathways

  • Relationship with Secreted Virulence Proteins:

    • MOS1 functions alongside other secreted proteins like:

      • COA1 (coat of appressorium 1) - masks fungal cell wall components to evade host immune recognition

      • MrSVP - contributes to thermotolerance and virulence

      • MrBI-1 - regulates heat tolerance and apoptotic-like cell death

  • Developmental Regulation Network:

    • MOS1 influences the expression of transcription factors that regulate appressorium formation

    • Participates in the COH1-COH2 cascade that distinguishes between cuticle and hemocoel environments

  • Metabolic Integration:

    • Potential interaction with MrINV (extracellular invertase) pathways, which are important for sucrose utilization during plant association

Understanding these relationships provides insights into how M. robertsii coordinates its complex infection process across different microenvironments within the host.

How can MOS1 be targeted for development of novel biocontrol strategies?

The critical role of MOS1 in fungal pathogenicity makes it an attractive target for biocontrol development:

  • Small Molecule Inhibitor Design:

    • Structure-based design targeting the SH3 domain or transmembrane regions

    • High-throughput screening of compound libraries against recombinant MOS1

    • Development of peptidomimetics that disrupt protein-protein interactions

  • Genetic Engineering Approaches:

    • Creation of hypervirulent strains through MOS1 overexpression

    • Development of attenuated strains with modified MOS1 for specific applications

    • Heterologous expression of MOS1 in narrow host range species to potentially expand their utility

  • Combination Strategies:

    • Co-application of MOS1-targeting compounds with existing biocontrol agents

    • Synergistic approaches targeting multiple signaling pathways simultaneously

Future research should focus on elucidating the complete interactome of MOS1 to identify additional potential targets within its signaling network.

What methodological considerations are important when studying MOS1 in different experimental systems?

Researchers investigating MOS1 should consider the following methodological aspects:

  • Growth and Culture Conditions:

    • Standard culture on potato dextrose agar (PDA) at 26°C for 14 days for conidial collection

    • Use of specialized media for stress response studies (PDA supplemented with Congo red, Calcofluor white, sorbitol, H₂O₂, menadione, or NaCl)

  • Genetic Manipulation:

    • Agrobacterium tumefaciens AGL1-mediated transformation is effective for gene deletion and complementation

    • Construction of deletion vectors should include appropriate flanking sequences for homologous recombination

    • Selection using resistance markers like bar or benomyl

  • Protein Localization Studies:

    • C-terminal GFP fusion constructs under native promoter control

    • Appropriate controls (GFP-only expression) to differentiate background fluorescence

  • Virulence Assays:

    • Both topical infection and direct injection methods should be used to distinguish between cuticle penetration and hemolymph colonization defects

    • Galleria mellonella larvae provide a good model system for infection studies

    • Calculation of median lethal time (LT₅₀) is a standard measure of virulence

These methodological considerations ensure robust and reproducible research on MOS1 function and its role in fungal pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.