Recombinant Metarhizium robertsii Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Metarhizium robertsii Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

The Recombinant Metarhizium robertsii Signal peptidase complex catalytic subunit SEC11 (SEC11) is a recombinant protein derived from the fungus Metarhizium robertsii. This protein is part of the signal peptidase complex, which plays a crucial role in the processing of secreted proteins by removing the signal peptide, allowing these proteins to be correctly targeted and secreted outside the cell. The SEC11 protein is specifically involved in this process, ensuring that proteins destined for secretion are properly processed.

Characteristics of Recombinant SEC11

  • Expression System: The recombinant SEC11 protein is expressed in Escherichia coli (E. coli), a common host organism for recombinant protein production due to its well-understood genetics and ease of manipulation .

  • Protein Structure: The SEC11 protein consists of 172 amino acids and is fused with an N-terminal His tag, which facilitates purification using affinity chromatography .

  • Function: As part of the signal peptidase complex, SEC11 is involved in the cleavage of signal peptides from newly synthesized proteins, enabling them to be secreted or embedded in membranes correctly.

Table: Characteristics of Recombinant SEC11

CharacteristicDescription
Expression SystemEscherichia coli
Protein Length172 amino acids
TagN-terminal His tag
FunctionSignal peptide cleavage

Potential Applications in Biotechnology

The recombinant SEC11 protein could have applications in biotechnology, particularly in improving the secretion efficiency of proteins in fungal systems. This could enhance the production of enzymes or other proteins of interest for industrial or agricultural use.

References

  1. Liao X, Fang W, Lin L, Lu H-L, Leger RJS (2013). Metarhizium robertsii Produces an Extracellular Invertase (MrINV) That Plays a Pivotal Role in Rhizospheric Interactions and Root Colonization. PLoS ONE 8(10): e78118.

  2. Creative BioMart. Recombinant Full Length Metarhizium Robertsii Signal Peptidase Complex Catalytic Subunit Sec11(Sec11) Protein, His-Tagged.

  3. Frontiers in Fungal Biology. Tolerance to Abiotic Factors of Microsclerotia and Mycelial Pellets of Metarhizium robertsii.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
SEC11; MAA_08708; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) (Metarhizium anisopliae (strain ARSEF 23))
Target Names
SEC11
Target Protein Sequence
MLSSLQNPRQAAAQLMNFAMILSTAFMMWKGLSVATDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNVWQETAVGEVVVYNVKGKDIPIVHRVVRKFGTGDKAKLLTKGDNNNADDTDLYA RGQDYLEREDIIGSVIGYFPFVGYVTILLSEHPWLKTVMLGIMGLLVVIQRE
Uniprot No.

Target Background

Function

The recombinant Metarhizium robertsii Signal Peptidase Complex catalytic subunit SEC11 (SEC11) is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs during translocation (co-translationally or post-translationally) through the translocon pore into the endoplasmic reticulum.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.