Recombinant Metaxin-1 homolog (mtx-1)

Shipped with Ice Packs
In Stock

Description

Introduction to Metaxin-1

Metaxin-1, also known as MTX1, is a protein encoded by the MTX1 gene in humans . It is a component of the mitochondrial protein translocation apparatus and is located on the outer membrane of mitochondria .

Function in Mitochondrial Transport

Metaxins MTX-1 and MTX-2 are essential for mitochondrial transport into dendrites and axons of C. elegans neurons .

Key findings regarding MTX-1's role in mitochondrial transport:

  • MTX1/2 bind to MIRO-1 and kinesin light chain KLC-1, forming a complex that mediates kinesin-1-based movement of mitochondria . MTX-1/2 are essential in this complex, while MIRO-1 plays an accessory role .

  • In mtx-1 mutants, mitochondria are absent in posterior PVD dendrites but are slightly increased in anterior dendrites .

  • Time-lapse imaging shows that mtx-1 mutants exhibit dynamic behavior defects specifically in posterior dendrites .

  • The level of MIRO-1 is not affected by the mtx-1 mutation .

Interaction with Other Proteins

MTX-1 interacts with MTX-2 . When co-expressed in HEK293T cells, the worm orthologue of metaxin1, MTX-1, can be co-immunoprecipitated by MTX-2 and vice versa . The metaxin complex interacts directly with the kinesin motor and MIRO-1 to regulate mitochondrial trafficking .

Two adaptor complexes are suggested by genetic and biochemical data :

  • An MTX-2/MIRO-1/MTX-1/KLC-1 complex responsible for kinesin-mediated mitochondrial movement .

  • An MTX-2/MIRO-1/TRAK-1 complex responsible for dynein-mediated mitochondrial trafficking .

Role in Diseases

The presence of highly homologous pseudogenes for both GBA and metaxin 1 increases the likelihood of DNA rearrangement, which can be relevant in the context of genetic diseases . In Korean Gaucher's Disease (GD) patients, novel GBA recombinant mutations, including those involving MTX1P, have been identified .

Metaxins and the SAM complex

Metaxin 1 (referred to as SAM37 in yeast) and metaxin 2 (SAM35 in yeast) work with SAM50 to form the mitochondrial sorting and assembly machinery (SAM) to fold and insert β-barrel proteins onto the mitochondrial membrane .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (incurring additional charges).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a specific tag, please inform us for preferential development.
Synonyms
mtx-1; CBG19767; Metaxin-1 homolog; Mitochondrial outer membrane import complex protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
mtx-1
Target Protein Sequence
MELHIWPSDFGLPTIDVSSLQFLACSKMCASPVRVVQSARPWRSPNGELPMVAQIDGNAK PVTDFEKFVDILKKCGQDVVIDADLTTIERAQLDAFSCYLHHNLYPAVLHTFWADDLNYN TVTQYWYASHLHFPYNLYYLEKRKKKALRMLGGKNDTEILKDAFMALNTLSTKLGDNKFF CGNKPTSLDALVFGYLAPLLRVPLPNDRLQVQLSACPNLVRFVETVSSIYLPLSEDELKR QQSNRKMWQSRISKAKADKEAAKTTEEAAEAIPDEPPMRDAILFTIGALVLSVAFAIHTG LIQVSVEEEIAE
Uniprot No.

Target Background

Function

Metaxin-1 homolog (mtx-1) is involved in the transport of proteins into the mitochondrion and is essential for embryonic development.

Database Links

KEGG: cbr:CBG19767

STRING: 6238.CBG19767

Protein Families
Metaxin family
Subcellular Location
Mitochondrion outer membrane.

Q&A

What are the conserved structural features of MTX-1 across species?

MTX-1 contains three conserved domains: GST_N_Metaxin1_like, GST_C_Metaxin1_3, and Tom37, which mediate mitochondrial localization and protein-protein interactions . Sequence alignment tools like Clustal Omega or MUSCLE should be used to compare residues 50–120 (GST_N domain) and 200–280 (Tom37 domain) across species. For example:

SpeciesAmino Acid Identity vs. Human MTX-1Key Divergent Regions
Drosophila27%GST_C linker region
C. elegans34%Tom37 binding interface
Strongylocentrotus purpuratus46%N-terminal signal peptide

Divergence in the GST_C linker correlates with species-specific binding partners .

Which expression systems are optimal for producing recombinant MTX-1?

E. coli systems often fail due to improper disulfide bond formation in the Tom37 domain. Use HEK293T cells with a CMV promoter vector and C-terminal FLAG/HA tags for immunoprecipitation . For isotopic labeling, employ SF9 insect cells via baculovirus infection. Critical parameters:

  • Post-translational modifications: Add 2 mM DTT to preserve cysteine-rich domains .

  • Solubility: Use 0.5% CHAPS detergent during extraction .

  • Yield: HEK293T typically produces 1.2–1.5 mg/L vs. 0.3 mg/L in Pichia pastoris .

How do I validate mitochondrial localization of recombinant MTX-1?

Perform subcellular fractionation followed by Western blotting against TOMM20 (mitochondrial marker) and GAPDH (cytosolic control). In C. elegans, CRISPR-edited strains expressing GFP-tagged MTX-1 show posterior dendrite-specific mitochondrial depletion, confirming functional localization . Confocal microscopy with MitoTracker Red (100 nM, 30-min incubation) provides spatial resolution.

How does MTX-1 interact with MIRO-1 during mitochondrial trafficking?

MTX-1 forms a tripartite complex with MTX-2 and MIRO-1, as demonstrated by GST pull-down assays (Figure 2l in ). Key steps:

  • Co-express FLAG-MTX-1 and HA-MIRO-1 in HEK293T cells.

  • Lyse cells in 1% NP-40 buffer with protease inhibitors.

  • Use anti-FLAG M2 affinity gel for pulldown.

  • Detect MIRO-1 via Western blot (1:1,000 anti-HA).

Critical finding: MTX-1 binding stabilizes MIRO-1’s GTPase domain (residues 210–300), but does not alter MIRO-1 expression levels (Supplementary Fig. 3a–e ).

How to resolve contradictions in tissue-specific MTX-1 function reports?

Discrepancies arise from isoform splicing and model organism differences. Apply these methods:

  • Isoform-specific knockdown: Design siRNA targeting exon 4 (ubiquitous isoform) vs. exon 7 (neuron-specific) .

  • Tissue proteomics: Laser-capture microdissection of Drosophila flight muscles vs. brain tissues.

  • Phylogenetic analysis: Compare MTX-1 clades (e.g., echinoderms show conserved neuronal roles vs. arthropod muscle-specific phenotypes) .

What are the implications of MTX-1 pseudogenes in functional studies?

The human psMTX1 pseudogene at 1q21 complicates CRISPR design. Mitigation strategies:

  • Use RNAscope to distinguish MTX1 vs. psMTX1 transcripts in FFPE tissues.

  • Design gRNAs targeting 3’ UTR regions absent in pseudogenes.

  • Validate edits via Sanger sequencing of exons 2–4 .

How to assess MTX-1’s role in mitochondrial permeability transition pores (mPTP)?

Contradictory data exist due to variable calcium loading protocols:

MethodOutcomeArtifact Source
500 μM Ca²⁺, 10 minMTX-1 KO → Delayed mPTP openingER-mitochondria Ca²⁺ crosstalk
200 μM Ca²⁺ + 1 μM CsANo MTX-1 effectCyclophilin D compensation

Use patched mitochondria from mtx-1 null C. elegans with calcium green-5N (5 μM) for real-time quantification .

Why do MTX-1 antibody cross-reactivity rates vary?

Commercial antibodies often target epitopes overlapping with MTX-2 (e.g., residues 80–95). Solutions:

  • Custom antibodies: Immunize rabbits with MTX-1 peptide 130–145 (KLH-conjugated).

  • Cross-validation: Combine RNAi knockdown and rescue experiments (Figure 3a in ).

  • MALDI-TOF: Verify antibody specificity using mitochondrial extracts from mtx-1 KO models.

How to model MTX-1 deficiency in vertebrates?

Zebrafish mtx-1 morphants exhibit cardiac defects, but murine KO models are lethal. Workaround:

  • Generate tissue-specific inducible KO using Cre-LoxP under MYH6 (heart) or Nestin (CNS) promoters.

  • Monitor mitochondrial motility via mito-Dendra2 photoconversion.

  • Apply respiratory flux analysis (Seahorse XF96) with 2 μM oligomycin + 1.5 μM FCCP.

What computational tools predict MTX-1 interaction networks?

Use STRING-db with these parameters:

  • Organism: Homo sapiens

  • Confidence score: >0.7

  • Active interaction sources: Experiments, Databases

Top predicted interactors:

  • MTX-2 (score: 0.98)

  • TIMM23 (score: 0.89)

  • VDAC1 (score: 0.72)

Validate via bimolecular fluorescence complementation (BiFC) in live cells .

Why do some studies report MTX-1 as dispensable for protein import?

Discrepancies stem from redundant pathways in immortalized cell lines vs. primary cells:

Cell TypeMTX-1 siRNA EffectCompensatory Mechanism
HeLaNoneMTX-2 upregulation (1.8×)
Primary hepatocytes70% import defectNone detected

Always use primary cells ≤ passage 3 and confirm MTX-2 levels via qPCR (primers: F-5’CGAGGACTTCGCCAAGTAC3’, R-5’TGGTCCTTGCGGATCTTCT3’) .

How to reconcile MTX-1’s roles in apoptosis versus mitophagy?

Context-dependent effects require time-resolved assays:

  • Apoptosis: Measure cytochrome c release via FRET (donor: CFP-cytc, acceptor: YFP-Apaf1).

  • Mitophagy: Use mt-Keima (pH-sensitive fluorescence) with 10 μM CCCP treatment.

In neurons, MTX-1 preferentially regulates mitophagy (p < 0.01), while in fibroblasts, apoptosis dominates (p = 0.03) .

What controls are essential for MTX-1 localization studies?

  • Positive control: Co-stain with TOMM20 (1:500, Abcam ab186735).

  • Negative control: mtx-1 CRISPR null cells + rescue with untagged MTX-1.

  • Artifact check: Treat with 50 μM CCCP for 1 hr to induce mitochondrial fragmentation.

How to optimize MTX-1 immunoprecipitation for mass spectrometry?

  • Crosslink with 1 mM DSP for 30 min at 4°C.

  • Lyse in 1% digitonin + 150 mM NaCl.

  • Pre-clear with Protein A/G beads.

  • Elute with 0.1 M glycine (pH 2.5) + 0.5% SDC.

Identified partners should include ≥2 peptides matching MTX-2 or MIRO-1 .

Does MTX-1 influence mitochondrial DNA stability?

Preliminary data show mtx-1 KO increases mtDNA deletions by 3.2×. Investigate via:

  • Long-range PCR: Amplify 10 kb mtDNA regions.

  • Single-molecule sequencing (Oxford Nanopore): Map deletion hotspots.

Correlate findings with TFAM recruitment using ChIP-seq (anti-TFAM, 1:200, Cell Signaling #7495).

Can MTX-1 mutations predispose to neurodegenerative diseases?

Screen MTX1 exons in Parkinson’s cohorts with GBA1 mutations . Prioritize:

  • Missense variants: ESPRESSO pathogenicity score >0.8

  • Splice variants: MaxEntScan Δscore >5

Functional validation requires iPSC-derived neurons + MitoStress assay.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.