Recombinant Methanobrevibacter smithii UPF0059 membrane protein Msm_0030 (Msm_0030)

Shipped with Ice Packs
In Stock

Description

Primary Sequence and Domain Analysis

The amino acid sequence of Msm_0030 (MDTSLISIIIIAIALAMDAFSVSLTKGFTQKNLTKSQILYYGLFFGFFQFIMPVIGYICGTTISSFVSTVAPWIAFFLLLAIGLNMIRESLDSDDEYIMDTFSFKELTLLAVATSIDAFVGITFALLNMSLLLPCTIIGIVAFIFSISGIFIGKKLGNYFGDKFEILGGAVLILIGIKILLGY) suggests transmembrane domains, consistent with its classification as a membrane protein . Homology modeling and functional annotations (e.g., AlphaFold2 or trRosetta) may reveal interactions with manganese ions or membrane-bound transport systems .

Proposed Role as a Manganese Efflux Pump

Msm_0030 is annotated as a putative manganese efflux pump (MntP) based on sequence similarity to bacterial transporters . Manganese homeostasis is critical for enzymatic activity in methanogens, particularly in cofactor biosynthesis (e.g., molybdopterin) and redox reactions . While direct experimental validation is pending, its structural similarity to ion transporters positions it as a candidate for regulating intracellular manganese levels in M. smithii .

Genomic Context and Horizontal Gene Transfer

M. smithii genomes contain clusters of adhesin-like proteins (ALPs) and surface variation genes, which may interact with host glycan structures . While Msm_0030 is not directly linked to adhesion, its role in membrane integrity or ion transport could influence M. smithii's persistence in the gut ecosystem .

Comparative Genomics with Other UPF0059 Proteins

Msm_0030 shares structural features with UPF0059 proteins from other archaea and bacteria, such as Methanoculleus marisnigri (Memar_2039) and Stenotrophomonas maltophilia (Smlt4626) . This conservation highlights its potential as a target for studying membrane protein evolution across domains.

Table 2: Msm_0030 vs. Other UPF0059 Proteins

ProteinHostFunctionPurity
Msm_0030M. smithiiPutative manganese efflux pump>90%
Memar_2039M. marisnigriHypothetical membrane protein>85%
Smlt4626S. maltophiliaTransmembrane protein>85%
BCAH187_A5502B. cereusHypothetical membrane protein>85%

Challenges and Future Directions

  1. Functional Validation: Direct evidence for manganese transport activity in M. smithii is lacking. Electrophysiology or isotope-based assays could confirm its role .

  2. Structural Determination: Cryo-EM or X-ray crystallography would elucidate its interaction with manganese ions and membrane lipids .

  3. Host Interaction Studies: Exploring Msm_0030's role in M. smithii's colonization of the gut microbiome could reveal therapeutic targets for metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion.
Synonyms
mntP; Msm_0030; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Target Names
mntP
Target Protein Sequence
MDTSLISIIIIAIALAMDAFSVSLTKGFTQKNLTKSQILYYGLFFGFFQFIMPVIGYICG TTISSFVSTVAPWIAFFLLLAIGLNMIRESLDSDDEYIMDTFSFKELTLLAVATSIDAFA VGITFALLNMSLLLPCTIIGIVAFIFSISGIFIGKKLGNYFGDKFEILGGAVLILIGIKI LLGY
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanobrevibacter smithii UPF0059 membrane protein Msm_0030?

Methanobrevibacter smithii UPF0059 membrane protein Msm_0030 is a membrane-associated protein encoded by the Msm_0030 gene in M. smithii, the dominant archaeon found in the human gut microbiome. This protein belongs to the UPF0059 family of membrane proteins that are widely distributed across archaeal species. The recombinant form is typically expressed with tags (commonly His-tag) to facilitate purification and experimental applications. The protein plays a crucial role in M. smithii's cellular functions, likely contributing to its adaptation to the human gut environment and its interactions with other microbiome members .

How does M. smithii's membrane biology affect our understanding of Msm_0030?

Unlike bacterial membranes composed of lipid bilayers with fatty acids, M. smithii possesses a distinctive archaeal membrane structure consisting of a lipid monolayer with isoprenoid chains linked to glycerol via ether bonds. This unique membrane architecture provides exceptional stability in the anaerobic gut environment and influences how Msm_0030 functions .

The archaeal membrane characteristics that impact Msm_0030 include:

  • Enhanced stability against hydrolytic degradation due to ether linkages

  • Greater rigidity and lower permeability compared to bacterial membranes

  • Different thickness and lateral pressure profiles affecting protein conformation

  • Distinct lipid-protein interactions influencing function and topology

Methodologically, this means that researchers studying Msm_0030 must consider these unique membrane properties when designing experiments, particularly for protein extraction, purification, and functional reconstitution. Standard protocols developed for bacterial membrane proteins may require significant modifications to accommodate the distinct properties of archaeal membranes .

What are the optimal conditions for expressing and purifying recombinant Msm_0030?

Based on established protocols for archaeal membrane proteins, the optimal expression and purification conditions for recombinant Msm_0030 are as follows:

Expression System:

  • E. coli strain BL21(DE3) or Rosetta(DE3) for better handling of archaeal codon usage

  • Expression vector containing a T7 promoter and His-tag (N-terminal preferable for this protein)

  • Growth at 18-25°C after induction to promote proper folding

Induction Parameters:

  • Optical density (OD600) of 0.6-0.8 before induction

  • IPTG concentration: 0.1-0.5 mM

  • Induction duration: 16-20 hours at reduced temperature

Buffer Conditions:

  • Lysis buffer: Tris-HCl (pH 8.0), 150-300 mM NaCl, 10% glycerol, appropriate protease inhibitors

  • Purification buffer: Similar to lysis buffer with 20-40 mM imidazole for binding, 250-500 mM imidazole for elution

  • Final storage buffer: Tris-based buffer, pH 8.0 with 50% glycerol to maintain stability

Purification Strategy:

  • Affinity chromatography using Ni-NTA resin (exploiting the His-tag)

  • Size exclusion chromatography to enhance purity

  • Concentration to at least 0.1-1.0 mg/mL

  • Addition of glycerol (final concentration 50%) for storage

The purified protein should be aliquoted to avoid repeated freeze-thaw cycles and stored at -20°C or -80°C for long-term preservation. For working stocks, aliquots can be kept at 4°C for up to one week .

What analytical methods are recommended for characterizing the structure and function of Msm_0030?

A comprehensive characterization of Msm_0030 requires multiple complementary approaches:

Structural Analysis:

  • Circular Dichroism (CD) spectroscopy to assess secondary structure content

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS) to determine oligomeric state

  • Fourier-Transform Infrared Spectroscopy (FTIR) to analyze transmembrane domains

  • Advanced structural prediction using AlphaFold2 or trRosetta for generating computational models

  • Nuclear Magnetic Resonance (NMR) spectroscopy for atomic-level structural information

Functional Analysis:

  • Reconstitution into liposomes composed of archaeal-like lipids

  • Membrane potential assays to assess ion transport capabilities

  • Substrate binding assays if transport function is suspected

  • Co-immunoprecipitation to identify interacting partners

  • Localization studies using fluorescently tagged variants

For the most reliable structural information, researchers should employ multiple complementary techniques. For example, computational prediction methods like AlphaFold2 have been used successfully to predict archaeal protein structures and can be validated with experimental approaches such as CD spectroscopy .

How can researchers investigate potential interactions between Msm_0030 and other microbial or host proteins?

Investigating protein-protein interactions (PPIs) between Msm_0030 and other proteins requires specialized approaches that account for its membrane localization:

In Vitro Interaction Methods:

  • Pull-down assays using His-tagged Msm_0030 as bait against human gut microbiome extracts

  • Surface Plasmon Resonance (SPR) to measure binding kinetics with purified candidate interactors

  • Crosslinking coupled with mass spectrometry to identify proximal proteins

  • Microscale Thermophoresis (MST) for quantifying interactions in solution

In Silico Prediction Approaches:

  • Homology-based PPI prediction using known interactions of UPF0059 family members

  • Machine learning methods trained on archaeal PPI datasets

  • Structural docking studies using predicted models of Msm_0030 and potential partners

  • Co-evolution analysis to identify potentially interacting residues

Cellular Context Methods:

  • Bacterial/archaeal two-hybrid systems adapted for membrane proteins

  • Proximity-dependent biotin labeling (BioID or APEX) in heterologous expression systems

  • Co-localization studies in native or reconstituted systems

  • Functional complementation assays in genetically tractable archaea

These approaches should be combined with validation studies, such as mutagenesis of predicted interaction sites followed by interaction assays, to confirm the specificity and biological relevance of identified interactions .

What is known about the functional role of Msm_0030 in M. smithii biology?

While the specific function of Msm_0030 has not been fully characterized, several lines of evidence suggest potential roles based on its sequence, predicted structure, and genomic context:

  • Membrane Integrity Maintenance: As a membrane protein with multiple predicted transmembrane domains, Msm_0030 may contribute to the stability and integrity of M. smithii's unique archaeal membrane, particularly under the changing conditions of the human gut environment.

  • Transport Functions: The protein may participate in the transport of ions, metabolites, or signaling molecules across the cell membrane, potentially supporting M. smithii's central metabolic processes.

  • Environmental Sensing: Msm_0030 could function as part of a signaling system that allows M. smithii to sense and respond to environmental changes in the gut ecosystem, such as pH fluctuations or nutrient availability.

  • Intercellular Communication: Given M. smithii's extensive interactions with bacterial species in the gut, Msm_0030 might facilitate communication or resource exchange with bacterial partners.

Genomic analyses have shown that genes encoding membrane proteins in M. smithii are part of its core adaptation strategy to the human gut environment. The conservation of Msm_0030 across M. smithii strains suggests functional importance in this ecological niche .

How might Msm_0030 contribute to M. smithii's role in human health and disease?

M. smithii plays a pivotal role in human gut physiology and has been implicated in various health conditions. Msm_0030 may contribute to these processes in several ways:

Health AspectPotential Contribution of Msm_0030
Normal Gut FunctionMay support M. smithii's role in detoxifying hydrogen from bacterial fermentations
Inflammatory Bowel DiseaseCould influence M. smithii's interactions with the immune system or epithelial barrier
ObesityMight affect energy harvest efficiency from the diet through metabolic interactions
Microbiome StabilityPotentially mediates interactions with keystone bacterial species

Research has demonstrated that M. smithii forms metabolism-driven microbial networks with various bacterial genera including Bacteroides, Prevotella, Ruminococcus, and others. As a membrane protein, Msm_0030 could be involved in the molecular interactions that underpin these networks, potentially through direct contact, signaling, or metabolite exchange .

Furthermore, M. smithii exists in different cell variants, including small cell variants (SCVs) that can translocate across epithelial barriers and trigger inflammatory responses. Msm_0030 might play a role in the formation or function of these variants, thereby influencing host-microbe interactions in health and disease states .

What role might Msm_0030 play in methanogenesis and energy metabolism?

M. smithii generates energy through hydrogenotrophic methanogenesis, converting H₂ and CO₂ to methane according to the reaction: 4H₂ + CO₂ → CH₄ + 2H₂O. This process is central to M. smithii's ecological role and metabolic function. Msm_0030 may contribute to this process in several ways:

  • Substrate Acquisition: It could facilitate the uptake of methanogenesis substrates (H₂, CO₂, formate) across the cell membrane.

  • Membrane Potential Maintenance: Methanogenesis is linked to energy conservation through the generation of a membrane potential. Msm_0030 might participate in maintaining this potential or in the associated ion movements.

  • Metabolic Enzyme Complex Association: It may associate with key methanogenesis enzymes such as Methyl-Coenzyme M Reductase (MCR) or formylmethanofuran dehydrogenase (Fwd), helping to position these enzymes optimally within the membrane.

  • Product Export: Msm_0030 could be involved in the export of methane or other metabolic byproducts.

The methanogenesis pathway in M. smithii involves numerous membrane-associated processes, making it plausible that membrane proteins like Msm_0030 play supporting roles. Further experimental evidence is needed to clarify its specific contribution to these processes .

How can structural predictions enhance our understanding of Msm_0030 function?

Advanced protein structure prediction methods provide valuable insights into Msm_0030's potential functions:

Structural Prediction Approaches and Their Applications:

  • AlphaFold2 and trRosetta Modeling: These AI-based tools can generate high-confidence structural models of Msm_0030, revealing the arrangement of transmembrane helices, potential ligand-binding sites, and functional domains. The predicted structures can be used to:

    • Identify conserved structural motifs shared with proteins of known function

    • Guide site-directed mutagenesis experiments by highlighting functionally important residues

    • Serve as templates for molecular dynamics simulations to study conformational dynamics

  • Transmembrane Topology Prediction: Tools like TMHMM or Phobius can predict the orientation of Msm_0030 within the membrane, identifying cytoplasmic, transmembrane, and extracellular regions. This information helps understand:

    • Which protein domains interact with the intracellular machinery

    • Which regions might interact with extracellular factors or adjacent cells

    • How the protein might change conformation during functional cycles

  • Structural Classification and Comparison: Database comparison tools like DeepFri can relate Msm_0030's structure to known protein families, providing functional hypotheses based on structural similarities.

Recent research has demonstrated the effectiveness of combining sequence and structure information to improve annotation of M. smithii proteins. This integrated approach has successfully refined functional predictions for numerous proteins in the human gut archaeome .

What comparative genomic approaches can reveal insights about Msm_0030 evolution and adaptation?

Comparative genomics offers powerful approaches to understand Msm_0030's evolutionary history and adaptive significance:

Taxonomic Profiling Analysis:

A comprehensive comparative analysis across 15 identified genotypes of M. smithii reveals patterns of conservation and variation in Msm_0030:

AspectFindings and Implications
Sequence ConservationHighly conserved across gut isolates suggesting functional importance
Synteny AnalysisFlanking genes show stable genomic context, indicating limited recombination
Selection PressureEvidence of purifying selection suggests functional constraints
Horizontal Gene TransferLimited evidence of HGT involving this gene between archaeal species
Adaptation SignaturesVariants show environment-specific adaptations between oral and gut isolates

Methodological Approaches:

  • Phylogenetic Analysis: Constructing phylogenetic trees based on Msm_0030 sequences from diverse M. smithii strains can reveal evolutionary relationships and potential adaptive radiations.

  • Synteny Mapping: Analyzing the conservation of gene order around Msm_0030 across genomes provides insights into genome stability and evolutionary history.

  • Horizontal Gene Transfer Detection: Methods such as phylogenetic incongruence, anomalous sequence composition, or presence/absence patterns can identify potential HGT events involving Msm_0030.

Research has shown that approximately 2.6% of M. smithii metagenome-assembled genomes have exchanged up to 10±3 genes with other MAGs, indicating some level of genetic exchange. Understanding whether Msm_0030 has been subject to such exchanges helps elucidate its role in adaptation to different host environments .

How might Msm_0030 be targeted in therapeutic approaches aimed at modulating gut methanogen activity?

As research continues to establish links between M. smithii and various health conditions, Msm_0030 represents a potential therapeutic target:

Potential Therapeutic Strategies:

  • Small Molecule Inhibitors: Designing compounds that specifically bind to and modulate Msm_0030 function could alter M. smithii's metabolic activity or its interactions with other microbes.

  • Peptide-Based Approaches: Synthetic peptides that mimic interaction domains could disrupt protein-protein interactions involving Msm_0030.

  • Antibody-Based Therapeutics: For surface-exposed regions of Msm_0030, specific antibodies could be developed to modulate function or mark cells for immune clearance.

  • CRISPR-Based Technologies: Advanced gene editing approaches could potentially be adapted to specifically modify M. smithii Msm_0030 expression in situ within the gut microbiome.

Research Considerations:

When investigating Msm_0030 as a therapeutic target, researchers should consider:

The potential therapeutic applications highlight the importance of thoroughly characterizing Msm_0030's structure, function, and interaction network. As our understanding of this protein grows, so too will opportunities for targeted interventions in conditions associated with aberrant M. smithii activity .

What are the common challenges in working with recombinant archaeal membrane proteins and how can they be addressed?

Working with archaeal membrane proteins like Msm_0030 presents several technical challenges:

Expression Challenges and Solutions:

  • Codon Usage Bias: Archaeal genes often contain codons rarely used in common expression hosts like E. coli.

    • Solution: Use codon-optimized synthetic genes or specialized E. coli strains containing rare tRNA genes (e.g., Rosetta strains).

  • Membrane Insertion and Folding: Archaeal membrane proteins may not fold properly in bacterial expression systems due to differences in membrane composition and protein translocation machinery.

    • Solution: Express at lower temperatures (16-20°C) and use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)).

  • Protein Toxicity: Overexpression of membrane proteins can be toxic to host cells.

    • Solution: Use tightly controlled inducible expression systems and optimize induction conditions to balance yield and toxicity.

Purification Challenges and Solutions:

  • Detergent Selection: Standard detergents may not effectively solubilize archaeal membrane proteins due to the unique lipid composition of archaeal membranes.

    • Solution: Test a panel of detergents including DDM, LMNG, and archaeal-specific lipid mixtures.

  • Protein Stability: Archaeal membrane proteins may denature during purification.

    • Solution: Include stabilizing agents such as glycerol (50%) and specific lipids throughout the purification process.

  • Purity Assessment: Traditional methods like SDS-PAGE may not accurately represent membrane protein purity.

    • Solution: Complement with size exclusion chromatography and mass spectrometry.

These technical considerations are critical for obtaining functional recombinant Msm_0030 for structural and functional studies .

What quality control measures should be implemented when working with recombinant Msm_0030?

Rigorous quality control is essential when working with recombinant Msm_0030:

Production Quality Control:

  • Expression Verification: Western blot analysis using antibodies against the affinity tag (e.g., His-tag) to confirm successful expression.

  • Purity Assessment: SDS-PAGE with Coomassie staining should show >90% purity as indicated in product specifications.

  • Identity Confirmation: Mass spectrometry analysis to verify the correct protein sequence and check for post-translational modifications or truncations.

  • Homogeneity Analysis: Size exclusion chromatography to ensure a monodisperse protein preparation without significant aggregation.

Functional Quality Control:

  • Secondary Structure Verification: Circular dichroism spectroscopy to confirm proper folding with expected alpha-helical content for a membrane protein.

  • Stability Assessment: Thermal shift assays to evaluate protein stability under various buffer conditions.

  • Ligand Binding Assays: If ligands are known or predicted, binding assays to confirm functional competence.

  • Reconstitution Tests: Successful incorporation into liposomes or nanodiscs as a prerequisite for functional studies.

These quality control measures should be systematically documented to ensure reproducibility and reliability of subsequent experiments .

How can researchers effectively design experiments to elucidate the function of poorly characterized proteins like Msm_0030?

Determining the function of poorly characterized proteins like Msm_0030 requires a strategic experimental approach:

Experimental Design Framework:

  • Hypothesis Generation Stage:

    • Conduct comprehensive in silico analysis including structural prediction, sequence conservation patterns, and genomic context

    • Perform phylogenetic profiling to identify co-occurrence patterns with proteins of known function

    • Analyze expression patterns under different conditions through transcriptomic data

  • Initial Characterization Stage:

    • Develop knockout or knockdown systems to observe phenotypic changes

    • Perform localization studies to confirm membrane association and specific cellular distribution

    • Conduct preliminary interaction studies to identify binding partners

  • Functional Validation Stage:

    • Design specific assays based on hypothesized function (e.g., transport assays if a transporter role is suspected)

    • Perform complementation studies with mutant phenotypes

    • Use site-directed mutagenesis to test the importance of specific residues

  • System Integration Stage:

    • Study the protein in the context of relevant metabolic pathways

    • Investigate its role in interspecies interactions

    • Assess its contribution to adaptation to environmental changes

Methodological Considerations:

When designing these experiments, researchers should:

  • Include appropriate positive and negative controls

  • Use multiple complementary approaches to address the same question

  • Consider the unique biology of archaea and their distinct cellular architecture

  • Employ both in vitro reconstituted systems and in vivo approaches when possible

This systematic approach maximizes the chances of successfully elucidating Msm_0030's function despite the challenges inherent in studying poorly characterized archaeal proteins .

What are the most promising future research directions for understanding Msm_0030 and related archaeal membrane proteins?

Several promising research directions could significantly advance our understanding of Msm_0030:

  • High-Resolution Structural Studies: Using cryo-electron microscopy or X-ray crystallography to determine the atomic structure of Msm_0030, potentially revealing functional sites and mechanistic details.

  • Genetic Manipulation Systems: Developing more efficient genetic tools for M. smithii to enable in vivo functional studies through gene deletion, site-directed mutagenesis, or regulated expression.

  • Single-Cell Analysis: Applying emerging single-cell technologies to understand Msm_0030 expression and function in the context of M. smithii's heterogeneity within the gut environment.

  • Interspecies Interaction Studies: Investigating how Msm_0030 might mediate interactions between M. smithii and other microbiome members, particularly bacteria that form functional networks with this archaeon.

  • Host-Microbe Interface Research: Exploring potential interactions between Msm_0030 and host factors at the gut epithelial barrier.

These approaches would significantly enhance our understanding of this protein's role in archaeal biology and the human gut ecosystem .

How might advances in computational methods and structural biology transform our understanding of archaeal membrane proteins?

Emerging computational and structural biology approaches are poised to revolutionize archaeal membrane protein research:

Transformative Methodologies:

  • AI-Powered Structural Prediction: Tools like AlphaFold2 and RoseTTAFold are dramatically improving our ability to predict membrane protein structures without experimental determination, opening new avenues for understanding proteins like Msm_0030.

  • Integrative Structural Biology: Combining multiple experimental approaches (cryo-EM, NMR, crosslinking mass spectrometry) with computational modeling to generate comprehensive structural models even for challenging membrane proteins.

  • Molecular Dynamics Simulations: Increasingly powerful computational resources allow for simulation of membrane proteins within realistic archaeal membrane environments, providing insights into dynamic behaviors.

  • Deep Learning for Function Prediction: Novel machine learning approaches trained on the growing body of archaeal protein data can generate functional hypotheses based on subtle sequence and structural patterns.

These advances are particularly valuable for archaeal membrane proteins like Msm_0030, which have historically been challenging to study due to technical limitations and the relatively smaller research focus on archaea compared to bacteria or eukaryotes .

What implications does research on Msm_0030 have for our broader understanding of the human gut archaeome?

Research on Msm_0030 contributes to our evolving understanding of the human gut archaeome in several important ways:

  • Expanding Functional Annotations: Detailed characterization of Msm_0030 helps address the significant annotation gaps in archaeal genomes, where many genes remain labeled as "hypothetical" or "putative" proteins.

  • Understanding Archaeal Adaptation: Insights into Msm_0030's function illuminate how archaea like M. smithii have adapted to the human gut environment, potentially revealing unique mechanisms not found in bacteria.

  • Archaeal-Bacterial Interactions: Studying Msm_0030's potential role in interspecies interactions contributes to our understanding of the complex networks within the gut microbiome, where archaea play critical but often overlooked roles.

  • Evolutionary Perspectives: Analysis of Msm_0030 conservation and variation across archaeal species provides insights into the evolutionary history of gut archaea and their co-evolution with the human host.

  • Therapeutic Potential: Characterization of archaeal membrane proteins opens new possibilities for targeted interventions in conditions where gut archaea play a role, moving beyond the traditional focus on bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.