Recombinant Methanocaldococcus jannaschii CDP-diacylglycerol--serine O-phosphatidyltransferase (pssA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Properties and Substrate Specificity

The enzyme demonstrates distinct substrate preferences compared to bacterial homologs:

  • Preferred substrate: CDP-2,3-di-O-geranylgeranyl-sn-glycerol, a diether lipid unique to archaea .

  • Activity: Unlike E. coli pssA (subclass I), it shares functional similarities with B. subtilis pssA (subclass II), including divalent cation independence and cytoplasmic localization .

Key catalytic features:

  • Broad tolerance for nucleotide analogs in the active site .

  • Thermostable activity at 70°C, consistent with M. jannaschii’s hyperthermophilic habitat .

Recombinant Production and Purification

The protein is produced via a plasmid-based system in E. coli, followed by nickel-affinity chromatography . Advanced genetic tools developed for M. jannaschii, such as suicide plasmids (e.g., pDS210) and promoter cassettes (e.g., P<sub>sla</sub>), enable homologous recombination for strain engineering .

Purification yield:

  • 0.26 mg/L culture for affinity-tagged proteins (e.g., FLAG-twin Strep fusions) .

  • Homogeneity confirmed via SDS-PAGE and Western blot .

4.1. Functional Studies

  • Role in sulfite resistance: Genetic knockout studies linked pssA homologs to coenzyme F<sub>420</sub>-dependent sulfite reductase activity, critical for stress adaptation .

  • Structural genomics: Serves as a model for studying archaeal lipid biosynthesis due to its thermostability and ancient evolutionary lineage .

4.2. Comparative Analysis

FeatureM. jannaschii pssAB. subtilis pssAE. coli pssA
SubclassIIIII
Substrate specificityArchaeal CDP-lipidsBacterial CDP-lipidsCDP-diacylglycerol
Thermal stability70°CMesophilicMesophilic
Sequence homology40% identity to B. subtilis<10% identity

Significance in Biotechnology

  • Enzyme engineering: Insights into substrate flexibility support synthetic biology applications for novel lipid production .

  • Evolutionary studies: Phylogenetic analysis suggests horizontal gene transfer from bacteria to archaea, highlighting evolutionary adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag.
Synonyms
pssA; MJ1212; CDP-diacylglycerol--serine O-phosphatidyltransferase; Phosphatidylserine synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
pssA
Target Protein Sequence
MFSIRKIITISDYVTMLNIITGLLAILLNSFSLIYLSIIFDSLDGYVARKTGTVSDFGAE LDSISDVVSFGVAPAYLLYNNFESNLALISAIIFCLCGALRLARFGILNVKGFIGLPIPA GALLLVGFCQLINSYLINSILAILIGLLMISDIKYPKYPNKIFIYIFAVSLCLAIVGIPH FALMLCLIYAIYGIIKYIRGD
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1212

STRING: 243232.MJ_1212

Protein Families
CDP-alcohol phosphatidyltransferase class-I family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of CDP-diacylglycerol--serine O-phosphatidyltransferase in M. jannaschii?

CDP-diacylglycerol--serine O-phosphatidyltransferase (PssA) catalyzes the transfer of a phosphatidyl group from CDP-diacylglycerol to L-serine, forming phosphatidylserine and CMP. In M. jannaschii, this enzyme plays a crucial role in phospholipid biosynthesis pathways necessary for membrane formation. Given the hyperthermophilic nature of M. jannaschii, its PssA enzyme likely exhibits unique structural and functional adaptations compared to mesophilic homologs, enabling it to function optimally at temperatures around 80°C.

The enzyme likely interacts with archaeal-specific lipids, which contain ether-linked isoprenoid chains rather than the ester-linked fatty acids found in bacteria and eukaryotes. These unique membrane lipid characteristics require specialized enzymes like PssA that can function within the extreme conditions that M. jannaschii thrives in.

How does the genomic context of pssA in M. jannaschii provide insights into its physiological role?

The genomic context analysis of pssA in M. jannaschii can reveal functional associations and regulatory networks. Examination of neighboring genes often indicates co-regulated pathways or related metabolic functions. For M. jannaschii, a hyperthermophilic methanogen, the pssA gene likely exists in proximity to other genes involved in membrane lipid biosynthesis or adaptation to extreme conditions.

Growth experiments with M. jannaschii strains can be conducted at varying temperatures (65-85°C) as described for other genetic studies, with growth rates measured by optical density at 600 nm using appropriate spectrophotometry . Generation times at different temperatures (e.g., 111 minutes at 65°C versus 26 minutes at 85°C as observed for wild-type M. jannaschii) can provide context for understanding environmental adaptation of membrane biochemistry and the roles of enzymes like PssA.

What strategies can be employed for generating recombinant M. jannaschii pssA constructs?

For cloning and expressing M. jannaschii pssA, researchers should consider several approaches:

Homologous Expression: Based on recent advances in M. jannaschii genetic systems, homologous expression using the flagellin promoter (PflaB1B2) can be implemented . This approach involves:

  • Designing a suicide plasmid similar to pDS261 containing:

    • The pssA gene fused with an affinity tag (e.g., 3xFLAG-twin Strep tag)

    • The PflaB1B2 promoter to drive expression

    • Homologous flanking regions for chromosomal integration

    • The Psla-hmgA cassette as a selectable marker conferring mevinolin resistance

  • Linearizing the plasmid and transforming M. jannaschii cells grown at 65°C (for optimal DNA uptake due to membrane lipid composition differences at lower temperatures)

  • Selecting transformants on solid medium containing mevinolin (10-20 μM)

  • Confirming successful integration via PCR using primers targeting the flanking regions

Heterologous Expression: For higher yield requirements, E. coli-based expression systems can be utilized with thermostable protein considerations:

  • Optimizing codon usage for E. coli while maintaining the native amino acid sequence

  • Using specialized E. coli strains designed for toxic or difficult-to-express proteins

  • Incorporating a heat step (65-80°C) during purification to denature E. coli proteins

What are the optimal growth conditions for M. jannaschii when expressing recombinant pssA?

Optimal conditions for M. jannaschii growth and protein expression include:

Media Composition:

  • Base medium as described for M. jannaschii cultivation containing appropriate salts

  • H₂ and CO₂ mixture (80:20, v/v) at 3 × 10⁵ Pa as methanogenesis substrates

  • Supplementation with Na₂S (2 mM) as reducing agent

  • Additional reducing agents such as cysteine (2 mM) or titanium (III) citrate (0.14 mM)

  • Yeast extract (0.1%) to enhance growth rates and protein expression

Growth Parameters:

  • Temperature: 80°C for optimal growth; 65°C for transformation procedures

  • Shaking at 200 rpm in appropriate anaerobic vessels

  • Monitoring growth by measuring optical density at 600 nm

  • Expected generation times of approximately 26 minutes at optimal temperature

Expression Induction:
When using the PflaB1B2 promoter system, expression occurs constitutively with no need for specific inducers. Cells should be harvested when culture reaches mid-log phase (OD₆₀₀ of 0.5-0.7, corresponding to 2-4 × 10⁸ cells/ml) .

What purification protocols yield highest recovery of active recombinant M. jannaschii pssA?

Purification of recombinant M. jannaschii PssA requires protocols addressing its thermophilic nature:

For Homologously Expressed PssA with Affinity Tags:

  • Cell harvesting and lysis:

    • Harvest cells from 1L culture (approximately 0.8g wet weight)

    • Resuspend in potassium phosphate buffer (100 mM, pH 7)

    • Lyse cells following established protocols for M. jannaschii

    • Clarify lysate by centrifugation at 18,000 × g for 30 min at 4°C

  • Affinity purification:

    • Load supernatant onto a Strep-Tactin XT column pre-equilibrated with wash buffer (100 mM Tris-HCl, pH 8, 300 mM NaCl)

    • Wash with 4 column volumes of wash buffer

    • Elute with 10 mM D-biotin in wash buffer, collecting fractions

    • Analyze fractions by SDS-PAGE to identify those containing PssA (expected size can be calculated from amino acid sequence)

  • Additional purification steps (if needed):

    • Size exclusion chromatography to remove aggregates and further purify

    • Expected yield: 0.2-0.3 mg purified protein per liter of culture based on similar protocols

Verification of Purified Protein:

  • SDS-PAGE analysis for purity assessment

  • Western blot using anti-FLAG antibodies to confirm tag presence

  • Mass spectrometry analysis of thermolysin digests to verify identity

  • Activity assays at elevated temperatures (65-85°C)

How can the thermostability of purified M. jannaschii pssA be preserved during storage and handling?

Maintaining thermostability of purified M. jannaschii PssA requires careful consideration of storage conditions:

Buffer Optimization:

  • Tris-HCl buffer (50-100 mM, pH 7.5-8.0) with 150-300 mM NaCl

  • Addition of glycerol (10-20%) to prevent freeze damage

  • Consider adding reducing agents (1-5 mM DTT or β-mercaptoethanol) if the enzyme contains critical cysteine residues

Storage Recommendations:

  • Short-term (1-2 weeks): 4°C with preservatives such as 0.02% sodium azide

  • Long-term: -80°C in small aliquots to avoid freeze-thaw cycles

  • Flash freezing in liquid nitrogen before transferring to -80°C

Handling During Experiments:

  • Pre-warm buffers to 65-80°C before adding enzyme

  • Consider adding stabilizing agents such as BSA (0.1 mg/ml) for dilute enzyme solutions

  • Use temperature-controlled reaction vessels to maintain optimal temperatures during assays

Testing Thermostability:
Monitor activity retention after:

  • Storage at different temperatures (4°C, -20°C, -80°C) for various durations

  • Multiple freeze-thaw cycles

  • Incubation at different temperatures (65°C, 80°C, 95°C) for extended periods

What assay systems effectively measure M. jannaschii pssA enzymatic activity?

Several assay methods can be employed to measure PssA activity, each with advantages for different research questions:

Radiometric Assays:

  • Substrate: ¹⁴C-labeled CDP-diacylglycerol or ³H-labeled L-serine

  • Procedure: Incubate labeled substrate with enzyme at 80°C, extract lipids using chloroform:methanol, separate by TLC, and quantify by scintillation counting

  • Advantages: High sensitivity; directly measures product formation

  • Considerations: Requires radioisotope handling facilities; specialized waste disposal

HPLC-Based Assays:

  • Procedure: Separate reaction products (phosphatidylserine and CMP) by HPLC

  • Detection: UV absorbance (for CMP) or evaporative light scattering (for phospholipids)

  • Advantages: No radioactivity; quantitative analysis of both substrates and products

  • Temperature considerations: Reaction conducted at 80°C before analysis at room temperature

Coupled Enzyme Assays:

  • Principle: Couple CMP production to secondary reactions that generate spectrophotometric signals

  • Implementation: Maintain coupling enzymes at lower temperature while PssA reaction occurs at high temperature

  • Challenges: Finding thermostable coupling enzymes or creating a two-phase temperature system

Expected Activity Parameters:

Temperature (°C)Relative Activity (%)pH OptimumSalt Concentration (mM NaCl)
6045-557.0-7.5200-300
7070-807.5-8.0250-350
8090-1008.0-8.5300-400
9060-708.0-8.5350-450

How do substrate specificity patterns of M. jannaschii pssA compare with mesophilic homologs?

Investigation of substrate specificity requires systematic testing with various substrate analogs:

Experimental Approach:

  • Prepare a panel of CDP-diacylglycerol analogs with varying:

    • Acyl chain lengths (C8-C20)

    • Degrees of saturation

    • Isoprenoid versus fatty acid chains

    • Ether versus ester linkages

  • Test alternative amino alcohol acceptors:

    • L-serine (natural substrate)

    • D-serine (stereoisomer)

    • Ethanolamine

    • Threonine

    • Glycerol-3-phosphate

  • Measure relative activity with each substrate combination at optimal temperature (80°C)

Expected Findings:
M. jannaschii PssA likely shows preference for:

  • Ether-linked isoprenoid substrates reflecting archaeal membrane composition

  • Broader temperature range of activity than mesophilic homologs

  • Potentially different metal ion requirements for catalysis

  • Modified pH optima reflecting intracellular pH at high temperatures

Data Representation:
Results can be presented as percent relative activity compared to the natural substrate combination:

Substrate VariationMesophilic PssA Relative Activity (%)M. jannaschii PssA Relative Activity (%)
CDP-diacylglycerol (C16) + L-serine100100
CDP-archaeol + L-serine10-2090-100
CDP-diacylglycerol (C16) + D-serine<5<5
CDP-diacylglycerol (C16) + ethanolamine40-5010-20
CDP-diacylglycerol (C8) + L-serine40-6030-50
CDP-diacylglycerol (C20) + L-serine30-5060-80

What crystallization approaches are most suitable for obtaining M. jannaschii pssA structural data?

Obtaining structural data for M. jannaschii PssA requires specialized approaches for thermostable membrane-associated proteins:

Protein Preparation:

  • High purity (>95% by SDS-PAGE) is essential

  • Concentrate to 10-15 mg/ml using appropriate molecular weight cutoff filters

  • Ensure monodispersity by dynamic light scattering prior to crystallization attempts

Crystallization Strategies:

  • Vapor Diffusion Methods:

    • Screening at elevated temperatures (20-45°C)

    • Inclusion of detergents (DDM, LDAO) if membrane association is present

    • Higher salt concentrations (200-500 mM) than typically used for mesophilic proteins

  • Lipidic Cubic Phase (LCP):

    • Particularly useful if PssA shows strong membrane association

    • Mixed with monoolein or other lipids suitable for thermophilic membrane proteins

    • Dispensed using LCP robots and incubated at 20-37°C

  • Co-crystallization:

    • With substrates or substrate analogs

    • With product analogues

    • With inhibitors to trap different conformational states

X-ray Diffraction:

  • Collection at synchrotron sources with high-brightness beamlines

  • Consideration of crystal stability and radiation damage

  • Processing with standard crystallographic software packages

Alternative Structural Approaches:

  • Cryo-electron microscopy for challenging crystallization targets

  • Small-angle X-ray scattering (SAXS) for solution structure and conformational studies

  • NMR for dynamic studies of specific domains or smaller constructs

How can molecular dynamics simulations provide insights into M. jannaschii pssA thermostability mechanisms?

Molecular dynamics (MD) simulations offer valuable insights into the thermostability mechanisms of M. jannaschii PssA:

Simulation Setup:

  • Build homology model if crystal structure unavailable, based on related structures

  • Embed in appropriate membrane environment mimicking archaeal lipids

  • Solvate system with explicit water and ions

  • Perform energy minimization and equilibration

Simulation Protocols:

  • Temperature-dependent simulations:

    • Run parallel simulations at 27°C (300K), 80°C (353K), and 95°C (368K)

    • Simulation time: minimum 100-500 ns per temperature condition

    • Compare structural stability, flexibility, and unfolding events

  • Analysis of stabilizing interactions:

    • Monitor ion pairs, hydrogen bonds, and hydrophobic interactions

    • Quantify water penetration into protein core

    • Analyze salt bridge networks and their persistence at high temperatures

    • Measure root mean square deviation (RMSD) and fluctuation (RMSF)

  • Substrate binding simulations:

    • Dock substrates into active site

    • Simulate enzyme-substrate complex at different temperatures

    • Analyze binding pocket dynamics and substrate orientation

Expected Findings:

  • Increased number of ion pairs compared to mesophilic homologs

  • More rigid protein core with flexible surface loops

  • Reduced cavity volumes within the protein structure

  • Specialized water networks at protein surface

  • Enhanced hydrophobic packing in the protein core

How can the essentiality of pssA in M. jannaschii be determined through genetic approaches?

Determining the essentiality of pssA in M. jannaschii requires sophisticated genetic manipulation approaches:

Gene Deletion Strategy:

  • Construct a suicide plasmid similar to pDS210 containing:

    • 500 bp upstream homologous region of pssA

    • 500 bp downstream homologous region of pssA

    • Psla-hmgA selectable marker cassette conferring mevinolin resistance

  • Transform M. jannaschii cells grown at 65°C with linearized plasmid following established protocols :

    • Harvest cells at OD600 0.5-0.7

    • Resuspend in pre-reduced medium

    • Incubate with linearized plasmid at 4°C

    • Heat shock at 85°C for 45 seconds

    • Recover overnight at 80°C

    • Plate on selective medium containing mevinolin

  • Screen transformants for successful deletion:

    • PCR verification with primers flanking the targeted region

    • Sequencing confirmation

    • Growth phenotype characterization

Conditional Knockdown Approaches:
If pssA proves essential (no viable knockouts obtained):

  • Develop a regulated promoter system for M. jannaschii

  • Replace the native pssA promoter with the regulated promoter

  • Analyze growth under repressing/inducing conditions

Complementation Studies:

  • Develop a complementation vector carrying:

    • Wild-type pssA under control of a constitutive promoter

    • Compatible selectable marker (e.g., simvastatin resistance)

  • Transform conditional mutants or heterozygous knockouts

  • Assess restoration of normal growth phenotype

Growth Analysis Parameters:

  • Temperature range: 65-85°C

  • Growth rates in liquid culture (generation time)

  • Colony formation on solid media

  • Cell morphology via microscopy

  • Membrane integrity assessments

What phenotypic analyses can reveal the physiological impact of pssA mutations in M. jannaschii?

Comprehensive phenotypic analysis of pssA mutants can provide insights into its physiological roles:

Membrane Composition Analysis:

  • Extract total lipids from wild-type and mutant strains

  • Analyze phospholipid composition by:

    • Thin-layer chromatography (TLC)

    • Liquid chromatography-mass spectrometry (LC-MS)

    • Nuclear magnetic resonance (NMR)

  • Quantify changes in phosphatidylserine content and other phospholipids

Growth Characteristic Assessment:

  • Growth curve analysis at different temperatures (65°C, 75°C, 85°C)

  • Pressure tolerance testing (relevant for deep-sea organisms)

  • Stress response to:

    • Osmotic shock (varying salt concentrations)

    • pH fluctuations

    • Nutrient limitation

Cellular Ultrastructure:

Metabolic Impact:

  • Methanogenesis rates under different conditions

  • Metabolomic profiling using mass spectrometry

  • Gene expression analysis of related pathways

Expected Phenotypic Changes in pssA Mutants:

ParameterWild-typepssA Conditional Mutant (Low Expression)pssA Complemented Strain
Generation time at 80°C26 min45-60 min28-32 min
Phosphatidylserine content100% (baseline)20-30%90-100%
Membrane fluidityNormalIncreasedNear normal
Temperature toleranceGrowth at 85°CLimited growth above 75°CGrowth at 80-85°C
Cell morphologyRegular cocciIrregular, possibly lysedMostly regular cocci

How can isothermal titration calorimetry be optimized for measuring M. jannaschii pssA binding thermodynamics at elevated temperatures?

Isothermal Titration Calorimetry (ITC) for thermophilic enzymes like M. jannaschii PssA presents unique challenges that require specialized approaches:

Instrument Modifications and Preparations:

  • Ensure ITC instrument can operate reliably at elevated temperatures (up to 80°C)

  • Perform thorough degassing of all solutions to prevent bubble formation

  • Pre-equilibrate cell and syringe at target temperature for extended periods

  • Use pressure-resistant cells if available

Experimental Design:

  • Temperature range: Start with lower temperatures (40-60°C) and gradually increase to physiological range (80°C)

  • Buffer selection: Use buffers with low heat of ionization and good temperature stability

    • HEPES or phosphate rather than Tris

    • Include stabilizing agents (glycerol 5-10%)

    • Match buffer conditions precisely between protein and ligand solutions

  • Concentration optimization:

    • Protein: 10-50 μM (in cell)

    • Ligand: 100-500 μM (in syringe)

    • Adjust based on preliminary binding affinity estimates

Data Analysis Considerations:

  • Apply temperature-dependent corrections to baseline

  • Account for heat of dilution with careful control experiments

  • Derive complete thermodynamic profiles (ΔH, ΔS, ΔG)

  • Compare parameters across temperature range to understand entropy-enthalpy compensation

Expected Thermodynamic Parameters:

Temperature (°C)Kd (μM)ΔH (kcal/mol)TΔS (kcal/mol)ΔG (kcal/mol)
4015-25-8 to -12-2 to 0-6 to -8
608-15-10 to -150 to 2-7 to -9
802-8-12 to -183 to 5-8 to -10

What stopped-flow kinetic approaches can elucidate the reaction mechanism of M. jannaschii pssA?

Stopped-flow kinetics offers powerful insights into the reaction mechanism of M. jannaschii PssA, particularly when adapted for high-temperature measurements:

Instrument Setup for Thermophilic Enzymes:

  • High-temperature stopped-flow apparatus with temperature control up to 85°C

  • Pressure-resistant observation cells

  • Dead-time minimization (typically <2 ms)

  • Inline degassing systems to prevent bubble formation

Experimental Strategies:

  • Pre-steady-state kinetics:

    • Rapid mixing of enzyme with substrates

    • Monitoring reaction progress on millisecond timescale

    • Detection methods:

      • Fluorescence changes (intrinsic tryptophan or fluorescent analogues)

      • Absorbance changes

      • FRET-based assays if applicable

  • Order of substrate binding:

    • Single-mixing experiments with varied substrate concentrations

    • Double-mixing experiments with defined delay times

    • Product inhibition studies

  • Rate-limiting step determination:

    • Solvent isotope effects (H₂O vs. D₂O)

    • Temperature dependence studies (Arrhenius plots)

    • Viscosity effects

Data Analysis Approaches:

  • Global fitting of kinetic traces to reaction models

  • Determination of elementary rate constants

  • Construction of free energy profiles

  • Comparison with mesophilic homologs

Mechanistic Information to Extract:

  • Order of substrate binding (random vs. ordered)

  • Rate-limiting step in catalytic cycle

  • Conformational changes during catalysis

  • Temperature effects on reaction coordinate

How can comparative genomics elucidate the evolutionary adaptations of M. jannaschii pssA?

Comparative genomics approaches provide critical insights into how M. jannaschii PssA has evolved unique adaptations:

Sequence-Based Analyses:

  • Phylogenetic reconstruction:

    • Collect PssA homologs from diverse archaea, bacteria, and eukaryotes

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Construct maximum likelihood or Bayesian phylogenetic trees

    • Root trees appropriately to determine evolutionary relationships

  • Selection pressure analysis:

    • Calculate dN/dS ratios across the sequence

    • Identify positively selected sites potentially involved in thermoadaptation

    • Compare conservation patterns between thermophilic and mesophilic groups

  • Domain architecture analysis:

    • Identify conserved domains using Pfam, CDD, or InterPro

    • Compare domain organization across taxonomic groups

    • Identify lineage-specific insertions or deletions

Structural Bioinformatics:

  • Generate structural models of PssA from various temperature groups

  • Analyze differences in:

    • Surface charge distribution

    • Hydrophobic core packing

    • Ion pair networks

    • Disulfide bond presence

Genomic Context:

  • Examine gene neighborhood conservation across archaea

  • Identify co-evolved genes potentially involved in related functions

  • Infer horizontal gene transfer events if present

Expected Evolutionary Patterns:

  • Presence of thermoadaptation signatures in amino acid composition

  • Potential horizontal gene transfer events in evolutionary history

  • Lineage-specific adaptations in substrate binding sites

  • Conservation patterns reflecting functional constraints

What directed evolution approaches can enhance recombinant M. jannaschii pssA for biotechnological applications?

Directed evolution of M. jannaschii PssA requires specialized approaches considering its thermophilic nature:

Library Generation Strategies:

  • Error-prone PCR:

    • Optimize mutagenesis rate (2-5 mutations per kb)

    • Target specific domains or the entire gene

    • Consider using thermostable DNA polymerases with adjustable fidelity

  • DNA shuffling:

    • Shuffle pssA genes from different thermophilic archaea

    • Focus on combining beneficial features while maintaining thermostability

  • Site-saturation mutagenesis:

    • Target residues identified from structural or sequence analysis

    • Create focused libraries at catalytic residues or substrate binding sites

Selection/Screening Systems:

  • Growth-based selection:

    • Develop a phosphatidylserine-auxotrophic host strain

    • Transform with mutant libraries

    • Select variants supporting growth under defined conditions

  • High-throughput activity screens:

    • Develop colorimetric or fluorescent assays adaptable to microplate format

    • Screen at varying temperatures, pH, or substrate conditions

    • Implement robotic systems for increased throughput

  • Thermostability screening:

    • Heat treatment of variant libraries before activity testing

    • Differential scanning fluorimetry in 96-well format

    • Protein solubility reporters

Improvement Targets:

  • Enhanced thermostability beyond native range

  • Expanded substrate specificity

  • Increased catalytic efficiency (kcat/Km)

  • Tolerance to organic solvents for biocatalysis applications

  • Stability at lower temperatures for broader application range

Iterative Improvement Strategy:

  • Perform 3-5 rounds of mutation and selection

  • Combine beneficial mutations from different rounds

  • Characterize improvements at molecular level

  • Test engineered variants in actual process conditions

What strategies can overcome expression challenges when working with recombinant M. jannaschii pssA?

Troubleshooting expression challenges with recombinant M. jannaschii PssA requires systematic approaches:

Common Challenges and Solutions:

  • Low expression levels:

    • Optimize codon usage for expression host

    • Test different promoter strengths (T7, tac, arabinose-inducible)

    • Vary induction conditions (temperature, inducer concentration, duration)

    • Consider specialized expression strains (e.g., Rosetta for rare codons)

  • Protein insolubility:

    • Express at lower temperatures (16-30°C) in E. coli

    • Use solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Add stabilizing agents to lysis buffer (glycerol, specific salts)

  • Protein misfolding:

    • Consider homologous expression in M. jannaschii using the established genetic system

    • Try expression in moderate thermophiles as intermediate hosts

    • Implement protein refolding protocols from inclusion bodies

  • Proteolytic degradation:

    • Include protease inhibitors during purification

    • Use protease-deficient expression strains

    • Optimize cell lysis and purification speed

Expression Optimization Decision Tree:

  • First attempt: Standard E. coli expression with optimized gene

  • If insoluble: Try lowering temperature and adding solubility tags

  • If low expression: Optimize codons and try different promoters

  • If still problematic: Move to homologous expression in M. jannaschii

  • If activity issues: Implement proper folding verification methods

Diagnostic Tests:

  • Western blot analysis of whole cell, soluble, and insoluble fractions

  • RT-qPCR to verify transcription levels

  • Mass spectrometry to identify truncation or modification issues

How can activity assays be adapted for troubleshooting recombinant M. jannaschii pssA functionality?

Adapting activity assays for troubleshooting recombinant M. jannaschii PssA requires consideration of both thermophilic properties and potential expression issues:

Tiered Assay Approach:

  • Basic functionality tests:

    • Simplified endpoint assays at various temperatures (30-85°C)

    • Detection of product formation by TLC or mass spectrometry

    • Comparison with heat-denatured negative controls

  • Thermostability verification:

    • Thermal shift assays using differential scanning fluorimetry

    • Activity retention after incubation at elevated temperatures

    • Circular dichroism to assess secondary structure at different temperatures

  • Substrate binding assessment:

    • Fluorescence-based binding assays if applicable

    • Isothermal titration calorimetry at various temperatures

    • Surface plasmon resonance with temperature control

Troubleshooting-Specific Assays:

  • Cofactor dependence testing:

    • Vary divalent cations (Mg²⁺, Mn²⁺, Ca²⁺)

    • Test different reducing conditions

    • Examine buffer composition effects

  • Folding assessment:

    • Limited proteolysis patterns compared to native enzyme

    • Intrinsic fluorescence spectroscopy

    • Hydrodynamic radius determination by size exclusion chromatography

  • Domain functionality testing:

    • Express individual domains if multidomain structure

    • Test for partial activities

    • Design chimeric constructs with well-expressed homologs

Assay Conditions Optimization Matrix:

ParameterRange to TestExpected Optimal Conditions
Temperature30-95°C in 10°C increments75-85°C
pH6.0-9.0 in 0.5 increments7.5-8.5
[NaCl]0-500 mM200-400 mM
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺ (0-10 mM)Mg²⁺ 2-5 mM
Reducing agentsDTT, β-ME, TCEP (0-10 mM)DTT 1-2 mM

How might synthetic biology approaches leverage M. jannaschii pssA for novel applications?

M. jannaschii PssA offers unique opportunities for synthetic biology applications leveraging its thermostability and catalytic properties:

Membrane Engineering Applications:

  • Development of thermostable artificial cell membranes with customized phospholipid composition

  • Creation of temperature-resistant liposomes for drug delivery systems

  • Engineering hybrid membranes combining archaeal and bacterial/eukaryotic lipid features

Biocatalysis Platforms:

  • Design of multi-enzyme cascades operating at elevated temperatures

  • Development of immobilized enzyme systems for industrial phospholipid synthesis

  • Creation of cell-free reaction systems for phospholipid production

Biosensor Development:

  • Enzyme-based biosensors for detecting lipid precursors

  • Temperature-robust environmental monitoring systems

  • Integration with nanotechnology platforms for enhanced sensitivity

Methodological Approaches:

  • Enzyme engineering:

    • Rational design based on structural insights

    • Directed evolution for altered substrate specificity

    • Computational design of novel catalytic functions

  • Pathway engineering:

    • Reconstruction of archaeal phospholipid synthesis pathways in model organisms

    • Creation of hybrid pathways combining elements from different domains of life

    • Metabolic flux optimization for enhanced production

  • System integration:

    • Combination with other thermostable enzymes

    • Development of temperature-triggered bioswitches

    • Incorporation into synthetic cells or protocells

Expected Challenges and Solutions:

  • Maintaining enzyme activity in non-native environments

  • Integrating with mesophilic components

  • Scaling production for practical applications

What computational approaches can predict structure-function relationships in M. jannaschii pssA variants?

Advanced computational methods offer powerful approaches for understanding structure-function relationships in M. jannaschii PssA:

Structural Prediction Methods:

  • AlphaFold2 and RoseTTAFold implementation:

    • Generate high-confidence structural models of wild-type and variant PssA

    • Assess prediction confidence with PAE (predicted aligned error) plots

    • Compare with available experimental structures of related enzymes

  • Molecular dynamics frameworks:

    • Apply specialized force fields optimized for thermophilic proteins

    • Implement enhanced sampling techniques (metadynamics, replica exchange)

    • Simulate at elevated temperatures (80-95°C) for extended periods (>500 ns)

  • Quantum mechanics/molecular mechanics (QM/MM):

    • Model reaction mechanisms at electronic structure level

    • Calculate activation energies for catalytic steps

    • Compare reaction coordinates with mesophilic homologs

Function Prediction Approaches:

  • Machine learning models:

    • Train on datasets of enzyme variants with known properties

    • Extract sequence and structural features as input variables

    • Develop models to predict stability, activity, and substrate specificity

  • Network analysis:

    • Identify cooperative networks of amino acids using statistical coupling analysis

    • Map evolutionary covariance onto structural models

    • Predict effects of mutations on allosteric communication

  • Free energy calculations:

    • Compute binding free energies for substrates and products

    • Calculate folding stability changes upon mutation

    • Determine effects of temperature on conformational ensembles

Integration with Experimental Validation:

  • Design focused mutant libraries based on computational predictions

  • Test experimentally to validate computational models

  • Refine predictive models using new experimental data

  • Establish iterative design-build-test cycles

Expected Computational Resources:

  • High-performance computing clusters for MD simulations

  • GPU acceleration for machine learning implementations

  • Specialized software packages for enhanced sampling and free energy calculations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.