Recombinant Methanocaldococcus jannaschii Large-conductance mechanosensitive channel MscMJLR (MJ1143)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on customer preference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize fulfilling your request.
Synonyms
MJ1143; Large-conductance mechanosensitive channel MscMJLR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1143
Target Protein Sequence
MTITQMISEILMHNTVYNYILSLISIILFIVIGKYANALIERLADKLHKKSGIELDELLI RALSLPVAIAIILSGFYFGVNFLYLLPSLKTAVNEGILTAFILCVVVFFDRFLNELVERY LALTISKKTKKDVDDQIVVLTKKLVRLVVWVVGLLLILSNLGYDIKTLLAGLGIGGLAVA LASQNLVSNLIAGLIILTDKPFKIGNWITFSGGSGIVEDIGIRSTKIRATDNSIIVVPNS KLIDEIIQNVPSKNKWKVSTTIGVTYNTPVEKIRKAEEIIKNILLEHPNVEDEPITVYFK EFGDWSLNIQVVYYIKNSRYNGYQKYISTINEVNLKIKEEFDRKGIEFAFPTYTLYLKRD D
Uniprot No.

Target Background

Function

The Methanocaldococcus jannaschii large-conductance mechanosensitive channel MscMJLR (MJ1143) is a cation-selective channel that opens in response to membrane tension. It exhibits voltage rectification.

Database Links

KEGG: mja:MJ_1143

STRING: 243232.MJ_1143

Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MscMJLR and how does it differ from the related MscMJ channel?

MscMJLR (encoded by gene MJ1143) is a mechanosensitive channel identified in the archaeon Methanocaldococcus jannaschii that shares 44% amino acid sequence identity with another MS channel from the same organism, MscMJ. Despite this sequence similarity, MscMJLR exhibits distinctive functional properties that set it apart from MscMJ . The most significant differences include conductance properties and energy requirements for activation.

The conductance of MscMJLR is approximately 2 nS, which is remarkably 7-fold larger than the 270 pS conductance of MscMJ . Furthermore, unlike MscMJ, MscMJLR displays rectification in symmetric recording solutions, with conductance of 1.70 ± 0.03 nS at -40 mV and 2.20 ± 0.05 nS at +40 mV . Another critical distinction is that MscMJLR requires approximately 18 kT for activation, which is three times the energy needed to activate MscMJ, though comparable to the activation energy of E. coli MscL .

While both channels are blocked by 0.1 mM gadolinium, MscMJLR is not affected by amphipaths, which do influence MscMJ function . These differences suggest specialized roles for these channels in responding to different osmotic challenges in the archaeal cell membrane.

How is the MscMJLR protein expressed and purified for experimental studies?

For recombinant expression and purification of MscMJLR, researchers employ an E. coli expression system with a His₆-tag fusion strategy. The gene encoding MscMJLR is cloned into an appropriate expression vector and transformed into E. coli cells. Following expression, the recombinant protein undergoes single-step purification using a Ni-NTA affinity column .

SDS-PAGE analysis confirms the purified protein runs as an approximately 40 kDa band, which aligns with its predicted molecular weight . This approach yields sufficient quantities of purified protein for subsequent functional and structural studies. For control experiments, E. coli cells transformed with an empty plasmid are processed in parallel .

The purification protocol should be optimized considering the predicted isoelectric point (pI) of 8.8 for MscMJLR . Buffer conditions during purification must be carefully controlled to maintain protein stability and prevent aggregation, particularly because MscMJLR is a membrane protein from a hyperthermophilic organism.

What are the key structural features of MscMJLR?

MscMJLR exhibits several notable structural features that contribute to its function as a mechanosensitive channel:

How does the MscMJLR pore size correlate with its conductance properties?

The pore size of MscMJLR directly impacts its conductance properties, following biophysical principles of ion channel function. Using Hille's cylindrical pore model, researchers have calculated the diameter of the MscMJLR pore to be approximately 27 Å, based on its 2 nS conductance . This estimate uses the formula:

g=πd24ρlg = \frac{\pi d^2}{4\rho l}

Where:

  • g is the conductance (2 nS)

  • d is the pore diameter

  • ρ is the resistivity of the recording solution (measured as 49.7 Ωcm)

  • l is the bilayer thickness (assumed to be 35 Å)

This calculated pore diameter is approximately 3-fold larger than the 9 Å estimated for MscMJ, which corresponds well with the 7-fold difference in conductance between these channels . The correlation between pore size and conductance follows theoretical expectations, where conductance is proportional to the square of the pore diameter.

The remarkably large pore of MscMJLR explains its high conductance values and suggests it may serve as a "last resort" emergency release valve during extreme osmotic stress, allowing larger solutes to pass through when necessary for cell survival.

What experimental methods are used to characterize the mechanosensitive properties of MscMJLR?

Characterization of MscMJLR's mechanosensitive properties employs several specialized techniques:

  • Patch-clamp electrophysiology: The primary method for functional characterization is patch-clamp recording of reconstituted channel activity in artificial lipid bilayers or liposomes . This allows measurement of channel conductance, ion selectivity, and response to mechanical stimuli under controlled conditions.

  • Pressure-response analysis: Channel activity is recorded in response to negative pipette pressure, typically between 25-100 mmHg for MscMJLR activation . The relationship between open probability and applied pressure provides crucial information about mechanosensitivity.

  • Boltzmann distribution fitting: The channel open probability plotted against negative pipette pressure is fitted to a Boltzmann distribution function to quantify mechanosensitivity parameters . This yields values for:

    • Channel sensitivity to pressure (1/α): 1.7 ± 0.2 mmHg per e-fold change in open probability for MscMJLR

    • Free energy of activation (Γ or ΔG₀): ~18 kT for MscMJLR

    • Effective membrane area change (ΔA) between open and closed conformations

  • Pharmacological testing: Channel response to modulators such as gadolinium (0.1 mM blocks MscMJLR) and amphipaths (do not affect MscMJLR) helps distinguish it from other mechanosensitive channels .

  • Rectification analysis: Current-voltage relationships across different membrane potentials reveal the rectification properties of MscMJLR, showing asymmetric conductance at positive versus negative potentials .

The following table summarizes key mechanosensitive parameters comparing MscMJLR with MscMJ:

ParameterMscMJLRMscMJRatio (MscMJLR/MscMJ)
Conductance~2 nS270 pS~7
Pore diameter~27 Å~9 Å~3
Activation energy (ΔG₀)~18 kT~6 kT~3
Pressure sensitivity (1/α)1.7 mmHg~10 mmHg~0.17

How might the coiled-coil domains in MscMJLR contribute to its functional properties?

The coiled-coil domains uniquely present in MscMJLR but absent in MscMJ likely play crucial roles in determining the distinctive functional properties of MscMJLR . Coiled-coil structures consist of multiple α-helices that wind around each other to form a superhelical structure, typically stabilized by hydrophobic interactions at the interface between helices.

In mechanosensitive channels, coiled-coil domains often serve as mechanical coupling elements that transmit force from the membrane to the channel gate. The presence of two regions with high probability of forming coiled-coils in MscMJLR suggests these domains may:

  • Contribute to higher energy requirements: The coiled-coil domains could stabilize the closed conformation of MscMJLR, explaining why it requires ~18 kT for activation compared to only ~6 kT for MscMJ . The additional energy would be needed to disrupt the coiled-coil interactions during channel opening.

  • Influence rectification properties: The asymmetric conductance observed at positive versus negative potentials might result from voltage-dependent conformational changes in the coiled-coil regions, affecting the channel pore dimensions or ion permeation pathway .

  • Regulate mechanosensitivity: Coiled-coil domains could alter how membrane tension is sensed and transmitted to the channel gate, explaining the different pressure sensitivity between MscMJLR and MscMJ .

  • Facilitate protein-protein interactions: These domains might enable MscMJLR to interact with other cellular components, potentially integrating mechanical sensing with other cellular signaling pathways.

To experimentally investigate these hypotheses, targeted mutagenesis of the predicted coiled-coil regions followed by functional characterization would be valuable for understanding their specific contributions to MscMJLR function.

What is the physiological significance of having multiple mechanosensitive channels with different activation thresholds in M. jannaschii?

The co-existence of MscMJ and MscMJLR in M. jannaschii, with their distinct conductance properties and activation thresholds, suggests a sophisticated, hierarchical response mechanism to osmotic challenges . This strategy likely provides several evolutionary advantages:

  • Graded response to osmotic stress: The differential activation energies (6 kT for MscMJ vs. 18 kT for MscMJLR) enable a tiered response system . During mild osmotic downshock, only MscMJ would activate due to its lower energy threshold, allowing selective release of small solutes. During more severe osmotic challenges, MscMJLR would subsequently activate, providing additional solute release capacity.

  • Energy conservation: By having channels with different activation thresholds, the cell can minimize energy expenditure during osmotic adaptation. The lower-threshold MscMJ channels would activate first, potentially resolving mild osmotic imbalances without needing to open the larger MscMJLR channels, which would cause greater solute loss .

  • Functional redundancy with specialization: While both channels respond to membrane tension, their different conductances (270 pS for MscMJ vs. 2 nS for MscMJLR) suggest they may preferentially transport different solutes or quantities of solutes . This provides both backup safety mechanisms and specialized functions.

  • Adaptation to extreme environments: M. jannaschii thrives in extreme environments, including high pressure and temperature at deep-sea hydrothermal vents . The presence of multiple MS channels with different properties may be particularly important for survival under these fluctuating extreme conditions.

Studies in other prokaryotes suggest that this hierarchical arrangement of mechanosensitive channels with different conductances and activation thresholds is a common strategy for osmotic adaptation across microbial life , reflecting its evolutionary importance for cellular survival in variable environments.

How can researchers accurately measure the free energy of activation (ΔG₀) for mechanosensitive channels like MscMJLR?

Accurate measurement of the free energy of activation (ΔG₀) for mechanosensitive channels requires specialized methodologies that connect electrophysiological recordings with thermodynamic analysis:

  • Patch-clamp with controlled pressure application: The foundation of ΔG₀ determination is high-quality patch-clamp recordings where negative pressure is precisely controlled and channel open probability is accurately measured across a range of pressures . This requires stable recordings and calibrated pressure application systems.

  • Boltzmann distribution analysis: The relationship between open probability (Po) and applied pressure (P) follows a Boltzmann distribution that can be expressed as:

    Po=11+eα(P1/2P)P_o = \frac{1}{1 + e^{\alpha(P_{1/2} - P)}}

    Where:

    • P₁/₂ is the pressure at which Po = 0.5

    • α is a sensitivity constant related to the effective area change

  • Calculation of free energy components: The total free energy of activation (ΔG₀) can be calculated as:

    ΔG0=ΔGintrinsic+γΔA\Delta G_0 = \Delta G_{\text{intrinsic}} + \gamma \Delta A

    Where:

    • ΔG_intrinsic is the intrinsic energy barrier

    • γ is membrane tension

    • ΔA is the effective area change between closed and open states

  • Conversion to thermal energy units: The free energy is typically expressed in kT units (where k is Boltzmann's constant and T is temperature), allowing comparison between channels and across studies .

  • Control for membrane properties: Since membrane composition affects tension transmission to the channel, standardized lipid compositions should be used when comparing different channels.

For MscMJLR, this methodology has revealed a free energy of activation of approximately 18 kT, three times higher than the 6 kT required for MscMJ activation . This significant difference helps explain their distinct roles in the cellular response to osmotic challenges.

Researchers should be aware that temperature affects both thermal energy (kT) and potentially the conformational landscape of the channel, which is particularly relevant when studying proteins from hyperthermophiles like M. jannaschii that normally function at elevated temperatures.

What are the optimized conditions for functional reconstitution of MscMJLR in artificial membranes?

Successful functional reconstitution of MscMJLR requires careful attention to several experimental parameters:

  • Lipid composition: The choice of lipids significantly impacts channel function. For archaeal membrane proteins like MscMJLR, consider using lipids that mimic the native membrane environment of M. jannaschii, which contains unique ether-linked isoprenoid lipids rather than the ester-linked fatty acids found in bacteria and eukaryotes. Alternatively, standard mixtures such as azolectin (soybean lipids) or POPE:POPG (7:3) can be used for initial characterization .

  • Protein-to-lipid ratio: Optimize this ratio to achieve single-channel recordings. Typically, ratios between 1:1000 and 1:10000 (w/w) are appropriate, but this should be determined empirically for MscMJLR .

  • Reconstitution method: Several approaches are suitable:

    • Liposome reconstitution followed by patch-clamp of proteoliposomes

    • Direct incorporation into planar lipid bilayers

    • Tip-dip bilayer formation with incorporated protein

  • Buffer conditions: Since MscMJLR comes from a hyperthermophilic organism, consider the following:

    • pH: Typically 7.0-7.4 for initial characterization

    • Salt concentration: 200-400 mM KCl is standard for electrophysiology

    • Divalent cations: Include 5 mM MgCl₂ to stabilize the membrane

    • Reducing agent: 1-5 mM DTT may help maintain protein function

  • Temperature considerations: While M. jannaschii is hyperthermophilic (optimal growth at 85°C), standard electrophysiology is typically performed at room temperature. For more physiologically relevant measurements, consider using temperature-controlled chambers that can operate at elevated temperatures, although this significantly complicates the experimental setup .

  • Pressure application: For mechanosensitive channel studies, apply negative pressure (suction) to patch pipettes using a calibrated pressure clamp system or a manual syringe connected to a sensitive pressure transducer . Pressure should be applied gradually in 5-10 mmHg increments until channel activation is observed.

What experimental controls are essential when studying MscMJLR?

Rigorous experimental controls are critical for reliable characterization of MscMJLR:

  • Empty vector control: E. coli cells transformed with an empty plasmid should be processed in parallel with MscMJLR-expressing cells to rule out contamination from endogenous E. coli mechanosensitive channels .

  • Channel blocker controls: Apply 0.1 mM gadolinium, a known blocker of MscMJLR, to confirm the identity of the recorded channel activity . The block should be reversible upon washout.

  • Pressure threshold controls: Verify that channel activity is genuinely pressure-dependent by demonstrating consistent activation thresholds across multiple patches and showing that activity ceases when pressure is released .

  • Orientation controls: For reconstituted systems, determine the orientation of the channel in the membrane using side-specific modulators or antibodies against tags placed at known locations in the protein.

  • Conductance measurements: Obtain full current-voltage relationships under standardized ionic conditions to verify the characteristic ~2 nS conductance and rectification properties of MscMJLR .

  • MscMJ comparative controls: When possible, perform parallel experiments with MscMJ to validate the reported differences in conductance, rectification, and activation energy .

  • Membrane integrity checks: Before and after applying pressure, verify membrane integrity by monitoring baseline current stability and membrane capacitance to ensure that observed channel activity is not due to membrane breakdown.

  • Temperature controls: Since M. jannaschii is a hyperthermophile, consider testing channel function at different temperatures to determine how thermal energy affects activation properties.

  • Statistical validation: Ensure sufficient biological and technical replicates (minimum n=3, ideally n≥5) for all key measurements to enable robust statistical analysis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.