Recombinant Methanocaldococcus jannaschii Molybdate/tungstate transport system permease protein wtpB (wtpB)

Shipped with Ice Packs
In Stock

Description

Functional Role in Molybdate/Tungstate Transport

WtpB facilitates the transmembrane movement of molybdate (MoO₄²⁻) and tungstate (WO₄²⁻), essential for metalloenzyme synthesis in M. jannaschii. Key mechanistic insights include:

  • Substrate Specificity: Binds both ions with high affinity, though tungstate uptake is prioritized under low environmental concentrations .

  • Regulation: Expression of the wtpB gene is modulated by intracellular tungstate levels, though M. jannaschii lacks a canonical ModE-like transcriptional regulator .

  • Energy Coupling: ATP hydrolysis by WtpC drives conformational changes in WtpB, enabling ion translocation .

3.1. Thioredoxin-Mediated Redox Regulation

WtpB was identified as a target of Thioredoxin 1 (Trx1) in M. jannaschii, implicating it in oxidative stress response . Trx1 reduces disulfide bonds in WtpB, potentially reactivating the transporter under sulfite-rich conditions .

3.2. Metal Dependency in Hyperthermophiles

Comparative studies with Pyrococcus furiosus WtpA homologs reveal:

  • Tungstate Preference: WtpB-associated transporters selectively uptake tungstate even at nanomolar concentrations, critical for enzymes like tungsten aldehyde oxidoreductase .

  • Molybdate Substitution: Under tungstate scarcity, molybdate is incorporated into tungsten-dependent enzymes, though this compromises activity .

3.3. Recombinant Production Challenges

  • Codon Optimization: Rare tRNA genes (e.g., argU, ileX) are co-expressed in E. coli to enhance WtpB yield .

  • Thermostability: Retains function at temperatures up to 85°C, making it a model for studying ABC transporters in extremophiles .

Applications in Biotechnology

Recombinant WtpB is utilized for:

  • Structural Biology: Crystallization studies to resolve ion-channeling mechanisms .

  • Enzyme Engineering: Insights into metal selectivity inform the design of synthetic transporters .

  • Bioremediation: Potential use in heavy metal sequestration due to high ion-binding affinity .

Comparative Analysis with Homologs

OrganismTransport SystemMetal SpecificityRegulatory Mechanism
Methanocaldococcus jannaschiiWtpABCTungstate > MolybdateThioredoxin-mediated redox control
Pyrococcus furiosusWtpABCTungstate (high affinity)ATP-dependent conformational shifts
Escherichia coliModABCMolybdateModE-dependent transcriptional regulation

Future Directions

  • Cryo-EM Studies: Resolve full-length WtpB structure in lipid bilayers .

  • Metalloproteomics: Map metal-binding sites to engineer variants with altered specificity .

  • Synthetic Biology: Integrate WtpB into artificial cells for controlled metal uptake .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
wtpB; MJ1368; Molybdate/tungstate transport system permease protein WtpB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
wtpB
Target Protein Sequence
MEKFDIAMTVFLVMIFLFIFLPIIYMLSNPGDLNQLLDKEVIEAFKTTLLAGAVATLIAL IFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVIGIIILSFIYGIDIINFIGRYVVDN FWGIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTFFEISLPLIKNNIIS GIILSFARGISEVGAILIIAYYPKTVPILIYERFMSFGLDASKPISVGMILISIALFALL RMFGRMRGR
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex WtpABC, which is involved in molybdate/tungstate import. It is likely responsible for translocating the substrate across the membrane.
Database Links

KEGG: mja:MJ_1368

STRING: 243232.MJ_1368

Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii WtpB protein and what is its function?

Methanocaldococcus jannaschii wtpB (UniProt ID: Q58763) is a permease protein component of the molybdate/tungstate transport system. The full-length protein consists of 249 amino acids and functions as an integral membrane component responsible for the translocation of molybdate and tungstate ions across the cell membrane . This protein plays a crucial role in metal homeostasis within M. jannaschii, an extremophilic archaeon that thrives in high-temperature, anaerobic environments.

The protein is encoded by the wtpB gene (locus tag: MJ1368) in the M. jannaschii genome. As a permease component, wtpB forms part of a multicomponent ABC transporter system dedicated to the uptake of essential trace metals that serve as cofactors for various metalloenzymes involved in the unique methanogenic metabolism of this organism .

What expression systems are suitable for producing recombinant M. jannaschii WtpB?

The most established expression system for recombinant M. jannaschii wtpB protein is Escherichia coli. Commercial preparations of the protein typically use E. coli as the heterologous host for expression of the full-length protein (residues 1-249) fused to affinity tags such as the N-terminal His-tag . This approach offers several advantages including:

  • High expression yields

  • Well-established induction protocols

  • Compatibility with standard protein purification techniques

  • Ability to incorporate various affinity tags

Alternative expression strategies include:

Expression SystemAdvantagesChallenges
E. coliHigh yields, well-established protocolsPotential misfolding of membrane proteins
Homologous expression in M. jannaschiiNative folding environmentRequires specialized equipment, lower yields
Cell-free systemsAvoids toxicity issuesExpensive, may require optimization

Recent advances in genetic systems for M. jannaschii now make homologous expression possible, which could be advantageous for functional studies requiring native protein conformations .

What are the optimal storage conditions for recombinant M. jannaschii WtpB protein?

Proper storage of recombinant M. jannaschii wtpB protein is critical to maintain its structural integrity and functional properties. The recommended storage conditions are:

  • Long-term storage: -20°C to -80°C in small aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris-based buffer with 50% glycerol at pH 8.0

It is important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity . For reconstitution of lyophilized protein preparations, deionized sterile water is recommended to achieve a final concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 50% is advised for preparations intended for long-term storage .

How can genetic manipulation techniques be applied to study WtpB in M. jannaschii?

Recent developments in genetic systems for M. jannaschii enable more sophisticated studies of wtpB in its native context. A comprehensive approach employs the following methodological steps:

  • Transformation protocol: M. jannaschii cells can be transformed using a heat shock method without requiring CaCl₂ treatment. The procedure involves:

    • Harvesting cells at an optical density of 0.5-0.7 (2-4 × 10⁸ cells/ml)

    • Resuspending cells in pre-reduced medium containing sodium sulfide

    • Incubating at 4°C for 30 minutes

    • Adding linearized plasmid DNA (approximately 2 μg)

    • Further incubation at 4°C for one hour

    • Heat shock at 85°C for 45 seconds

    • Recovery at 4°C for 10 minutes

  • Selectable markers: Mevinolin resistance can be used for selection of transformants, typically yielding approximately 10⁴ resistant colonies per μg of plasmid DNA .

  • Homologous recombination: Double crossover homologous recombination between linearized suicide vectors and the chromosome can be used to:

    • Knock out genes of interest

    • Introduce affinity-tagged versions of proteins

    • Place genes under the control of engineered promoters

  • Expression verification: Successful genetic manipulation can be verified using PCR-based analysis of chromosomal DNA and Western blotting to confirm expression of modified proteins .

This genetic system provides powerful tools for investigating wtpB function through approaches such as gene knockout, promoter substitution, and expression of tagged variants for interaction studies and localization experiments.

What methods are effective for purifying recombinant M. jannaschii WtpB protein while maintaining its activity?

Purification of recombinant M. jannaschii wtpB requires specialized approaches due to its membrane protein nature and thermophilic origin. A comprehensive purification strategy includes:

  • Affinity chromatography: His-tagged versions of wtpB can be purified using immobilized metal affinity chromatography (IMAC) . Alternative affinity tags such as the 3xFLAG-Twin Strep tag have been successfully used for other M. jannaschii proteins and could be adapted for wtpB .

  • Detergent selection: Appropriate detergents must be selected to solubilize wtpB from membranes while preserving its native structure. Commonly used detergents include:

    • n-Dodecyl β-D-maltoside (DDM)

    • n-Octyl β-D-glucopyranoside (OG)

    • Lauryl maltose neopentyl glycol (LMNG)

  • Temperature considerations: Given the thermophilic nature of M. jannaschii, purification steps might benefit from elevated temperatures to maintain protein stability.

  • Buffer optimization: Based on research with other M. jannaschii proteins, buffers containing 10 mM Mg²⁺ at pH 8.5 may help maintain protein stability .

  • Verification methods:

    • SDS-PAGE to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry for definitive identification

For homologously expressed wtpB with a Twin Strep tag, purification using a Streptactin XT superflow column with elution using 10 mM D-biotin has been effective for other M. jannaschii proteins, with typical yields of approximately 0.26 mg purified protein per liter of culture .

How does the structure of WtpB relate to its function in the molybdate/tungstate transport system?

The structure-function relationship of wtpB can be analyzed through multiple approaches:

  • Sequence analysis: The wtpB amino acid sequence contains multiple hydrophobic segments consistent with a transmembrane protein architecture . These transmembrane domains likely form a channel or pore through which molybdate and tungstate ions are transported.

  • Homology modeling: While no experimentally determined structure is available for M. jannaschii wtpB, homology modeling based on related bacterial ABC transporter permeases can provide insights into:

    • The arrangement of transmembrane helices

    • Potential ion binding sites

    • Interfaces with ATP-binding cassette subunits

  • Functional domains: Key functional regions likely include:

    • Ion selectivity filter regions that distinguish between molybdate and tungstate

    • Coupling helices that interact with nucleotide-binding domains

    • Conserved motifs involved in conformational changes during transport

  • Experimental approaches: To further investigate structure-function relationships, researchers could employ:

    • Site-directed mutagenesis targeting conserved residues

    • Cysteine-scanning mutagenesis to probe accessibility

    • Crosslinking studies to identify interaction surfaces

    • Liposome reconstitution assays to measure transport activity

The highly hydrophobic nature of wtpB, with multiple predicted transmembrane segments, aligns with its function as a permease component that forms the translocation pathway for molybdate and tungstate ions across the membrane.

What are the challenges in expressing and studying membrane proteins from hyperthermophilic archaea?

Working with membrane proteins from hyperthermophilic archaea like M. jannaschii presents several unique challenges:

  • Expression barriers:

    • Codon usage differences between archaeal and bacterial hosts

    • Membrane composition differences (archaeal lipids vs. bacterial lipids)

    • Protein folding at non-native temperatures

    • Potential toxicity to mesophilic expression hosts

  • Solubilization challenges:

    • Selection of appropriate detergents that maintain protein stability

    • Mimicking the native archaeal membrane environment

    • Balancing solubilization efficiency with retention of native structure

  • Stability considerations:

    • Proteins may denature at temperatures below their physiological optimum

    • Standard buffers may not provide optimal stability

    • Repeated freeze-thaw cycles can significantly reduce activity

  • Functional assays:

    • Transport activity assays require reconstitution into liposomes

    • Temperature requirements (80°C optimal for M. jannaschii) exceed standard laboratory equipment specifications

    • Special anaerobic conditions may be needed to maintain protein activity

  • Crystallization difficulties:

    • Membrane proteins are inherently challenging to crystallize

    • Detergent micelles complicate crystal packing

    • High-temperature conditions may be needed for proper folding

These challenges can be addressed through strategies such as homologous expression systems , specialized purification protocols, and the use of thermostable detergents and lipids for reconstitution studies.

How can isotopic labeling techniques be applied to study the structure and dynamics of M. jannaschii WtpB?

Isotopic labeling provides powerful tools for structural and dynamic studies of membrane proteins like wtpB. A comprehensive approach would include:

  • Expression strategies for labeled wtpB:

    • Minimal media supplemented with ¹⁵N-ammonium chloride and/or ¹³C-glucose

    • Selective labeling of specific amino acid types

    • Deuteration to improve NMR signal quality

    • Cell-free expression systems for difficult constructs

  • NMR spectroscopy applications:

    • 2D and 3D heteronuclear NMR to assign backbone resonances

    • Methyl-TROSY approaches for large membrane proteins

    • Solid-state NMR of reconstituted protein in lipid bilayers

    • Paramagnetic relaxation enhancement to identify surface-exposed residues

  • Mass spectrometry approaches:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe dynamics

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Limited proteolysis coupled with MS to identify flexible regions

  • Specialized techniques for membrane proteins:

    • Reconstitution into nanodiscs or bicelles for solution NMR

    • 2D crystallization in lipid bilayers for electron crystallography

    • Detergent screening to optimize sample preparation

  • Data integration strategy:

    • Combining multiple techniques (NMR, MS, computational modeling)

    • Validating structural models against evolutionary conservation data

    • Correlating structural features with transport mechanism

These approaches would provide valuable insights into the structural basis of wtpB function, particularly the conformational changes associated with ion transport and interactions with other components of the transport system.

What methods can be used to assess the transport activity of recombinant WtpB?

Assessing the transport activity of recombinant wtpB requires specialized techniques due to its membrane protein nature and thermophilic origin. A comprehensive approach includes:

  • Liposome reconstitution assays:

    • Purified wtpB can be reconstituted into liposomes prepared from synthetic lipids or archaeal lipid extracts

    • Radioactive tracer studies using ⁹⁹Mo or ¹⁸⁵W can measure transport kinetics

    • Fluorescent probes can monitor ion-coupled changes in membrane potential

  • Whole-cell uptake assays:

    • Heterologous expression in transport-deficient bacterial strains

    • Comparison of molybdate/tungstate uptake between wild-type and wtpB-expressing cells

    • Competition assays to determine substrate specificity

  • ATPase coupling assays:

    • Measuring ATP hydrolysis by the associated ATPase component in response to substrate binding

    • Reconstitution of the complete transport complex (wtpA, wtpB, wtpC) to assess functional coupling

  • Electrophysiological methods:

    • Patch-clamp analysis of wtpB-containing proteoliposomes

    • Solid-supported membrane electrophysiology

    • Planar lipid bilayer recordings at elevated temperatures

These functional assays should ideally be performed under conditions that mimic the native environment of M. jannaschii, including:

  • Elevated temperatures (optimally around 80°C)

  • Anaerobic conditions

  • Appropriate pH (typically around 6.5-7.0)

  • Physiologically relevant ion concentrations

How does WtpB interact with other components of the molybdate/tungstate transport system?

The interaction of wtpB with other components of the molybdate/tungstate transport system can be investigated through multiple complementary approaches:

  • Co-purification studies:

    • Affinity-tagged wtpB can be used to identify interacting partners

    • Crosslinking followed by mass spectrometry can map interaction interfaces

    • Blue native PAGE can preserve and identify native complexes

  • Genetic approaches:

    • Knockout studies in M. jannaschii using the established genetic system

    • Complementation assays to verify functional relationships

    • Suppressor mutation analysis to identify genetic interactions

  • Structural biology methods:

    • Cryo-electron microscopy of the assembled transport complex

    • X-ray crystallography of subcomplexes

    • FRET-based approaches to monitor conformational changes

  • Computational predictions:

    • Homology modeling based on related bacterial ABC transporters

    • Molecular dynamics simulations of the transport cycle

    • Protein-protein docking to predict interaction surfaces

Based on homology to other ABC transport systems, wtpB likely interacts with:

  • wtpA: The ATP-binding cassette component that provides energy for transport

  • wtpC: A potential substrate-binding protein that recognizes molybdate/tungstate

  • The lipid bilayer: Through multiple transmembrane segments

Understanding these interactions is crucial for elucidating the complete transport mechanism and may provide insights into the adaptation of membrane transport systems to extreme conditions.

What research applications benefit from studies of M. jannaschii WtpB?

Studies of M. jannaschii wtpB contribute to multiple research areas:

  • Extremophile adaptation mechanisms:

    • Understanding how membrane proteins function at extreme temperatures

    • Elucidating structural adaptations that confer thermostability

    • Investigating metal homeostasis in extreme environments

  • Membrane transport protein engineering:

    • Developing thermostable transporters for biotechnological applications

    • Creating chimeric proteins with enhanced stability or altered specificity

    • Identifying critical residues that determine transport properties

  • Early evolution of life:

    • M. jannaschii occupies a deep branch in the archaeal phylogenetic tree

    • Transport systems represent ancient cellular functions

    • Comparative studies can reveal evolutionary conservation and divergence

  • Structural biology methodologies:

    • Advancing techniques for membrane protein structure determination

    • Developing approaches for proteins requiring extreme conditions

    • Refining computational prediction methods for membrane proteins

  • Biotechnological applications:

    • Development of thermostable biosensors for molybdate/tungstate

    • Bioremediation of metal-contaminated environments

    • Protein engineering for industrial processes at high temperatures

The genetic system developed for M. jannaschii opens new possibilities for in vivo studies of wtpB function, potentially leading to deeper insights into how this protein operates in its native context.

What future research directions are most promising for advancing understanding of M. jannaschii WtpB?

Several promising research directions could significantly advance our understanding of M. jannaschii wtpB:

  • High-resolution structural studies:

    • Cryo-EM structure of the complete molybdate/tungstate transport complex

    • X-ray crystallography of wtpB in different conformational states

    • Solid-state NMR studies of reconstituted wtpB in lipid environments

  • Single-molecule approaches:

    • FRET-based studies to monitor conformational dynamics during transport

    • Force spectroscopy to measure stability and unfolding pathways

    • Single-molecule transport assays to detect individual transport events

  • Systems biology integration:

    • Transcriptomic analysis of molybdate/tungstate response networks

    • Metabolomic studies of metal-dependent pathways

    • Interactome mapping of metal transport systems

  • Comparative studies across extremophiles:

    • Analyzing wtpB homologs from organisms adapted to different extreme environments

    • Identifying convergent adaptations in metal transport systems

    • Horizontal gene transfer patterns of transport components

  • Advanced genetic approaches:

    • CRISPR-based genome editing in M. jannaschii

    • Conditional expression systems for essential genes

    • In vivo fluorescent tagging for localization studies

  • Computational biology advances:

    • Molecular dynamics simulations at high temperatures

    • Machine learning approaches to predict membrane protein stability

    • Integrative modeling combining experimental data with computational prediction

These research directions would build upon the established genetic system for M. jannaschii and leverage emerging technologies to provide a more comprehensive understanding of wtpB structure, function, and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.