Recombinant Methanocaldococcus jannaschii Probable cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Methanocaldococcus jannaschii CobD (cobD) is a protein involved in the anaerobic biosynthesis pathway of cobalamin (vitamin B12), a critical coenzyme for methanogenesis and other biochemical processes in archaea. Produced via E. coli expression systems, this His-tagged recombinant protein enables functional and structural studies of cobalamin biosynthesis in extremophilic microorganisms .

Role in Cobalamin Biosynthesis

CobD is a key enzyme in the anaerobic cobalamin biosynthesis pathway, which differs from the aerobic pathway by incorporating cobalt early in the process and avoiding oxygen-dependent steps . In M. jannaschii, CobD operates within a gene cluster (cob operon) alongside other enzymes like CobS (MJ1438) and CobZ (MJ1330) . Comparative genomic analyses reveal that M. jannaschii, Bacillus megaterium, and Salmonella typhimurium share this anaerobic pathway, characterized by the presence of cobD and cobG but the absence of cobF and cobN .

Key Pathway Features:

  • Cobalt Integration: CobD facilitates cobalt insertion into the corrin ring, a defining step in anaerobic synthesis .

  • Operon Structure: The M. jannaschii cob operon includes 14–15 genes, with cobD phylogenetically linked to radical SAM enzymes involved in methyl transfer reactions .

  • Thermostability: Native CobD is inferred to retain activity under high temperatures (up to 85°C), consistent with M. jannaschii’s hyperthermophilic habitat .

Research Applications

Recombinant CobD is utilized to:

  • Elucidate Cobalamin Biosynthesis: Study enzyme kinetics, substrate specificity, and metal cofactor requirements in archaeal systems .

  • Engineer Synthetic Pathways: Develop microbial platforms for cobalamin production using extremophile-derived enzymes .

  • Structural Analysis: Investigate protein folding and stability under high-temperature conditions .

Comparative Genomic Insights

OrganismPathway TypeCobD Homolog Present?Key Distinctions
M. jannaschiiAnaerobicYesLacks cobF; uses radical SAM methyltransferases
Salmonella typhimuriumAnaerobicYesShares cobD but requires additional transporters
Pseudomonas denitrificansAerobicNoRelies on oxygen-dependent enzymes (e.g., CobF)

Technical Notes

  • Purification: Recombinant CobD is affinity-purified via its His-tag, ensuring high purity for crystallography or enzymology .

  • Stability: While the recombinant protein is produced in E. coli, native CobD likely requires thermophilic chaperones for optimal folding .

Research Challenges

  • Functional Redundancy: CobD’s role overlaps with other radical SAM enzymes in the cob operon, complicating in vivo knockout studies .

  • Structural Data: No crystal structure of CobD is currently available, limiting mechanistic insights compared to homologs like CobT .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
cobD; MJ1314; Probable cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
cobD
Target Protein Sequence
MLNPIILFLAIIFDRIIGELPESIHPTVWIGKLIAFLENIFKSTNCKNKYRDFLFGSLTT FITLLVVGVIAFFVDKCIMLLPFPLNYIIYGFLLSTTIGYKSLFEFCKKPIEYIKNGDLE GARKAVQHIVSRDASKLDKEHVLSAAVESLSENITDSIIGALFYAIFFGLPGAFVYRAIN TLDAMIGYKNEKYLWYGKLAARLDDIANFIPSRIAGILLIITAPFYKGDVKKAIYGFLKE ANKVPSPNSGYTMATLANALNITLEKIGYYKLGSGKIDVEKSLNAFKAVDYTVVVFLIIY TLIWWIT
Uniprot No.

Target Background

Function
This protein catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links

KEGG: mja:MJ_1314

STRING: 243232.MJ_1314

Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of CobD in cobalamin biosynthesis in Methanocaldococcus jannaschii?

CobD in methanogenic archaea like Methanocaldococcus jannaschii is hypothesized to function similarly to the bacterial CobD, which is involved in the attachment of aminopropanol to the f side chain of cobyric acid during cobalamin (vitamin B12) biosynthesis. In Salmonella enterica serovar Typhimurium, CobD functions as an L-threonine-O-3-phosphate decarboxylase that generates (R)-1-amino-2-propanol-O-2-phosphate . While direct experimental evidence for M. jannaschii CobD is limited, its role is inferred based on sequence homology and conserved cobalamin biosynthetic pathways in archaea.

How does the archaeal cobalamin biosynthesis pathway differ from bacterial pathways?

Archaea like Methanocaldococcus jannaschii are believed to utilize the anaerobic pathway for cobalamin biosynthesis, similar to the one found in Salmonella enterica. Key differences between archaeal and bacterial pathways include:

  • CobY in M. jannaschii functions as a non-orthologous replacement of bacterial NTP:AdoCbi kinase/GTP:AdoCbi-P guanylyltransferase, transferring the GMP moiety of GTP to AdoCbi-P to form AdoCbi-GDP .

  • Archaeal cobalamin biosynthesis enzymes often exhibit greater thermostability, reflecting the hyperthermophilic nature of organisms like M. jannaschii.

  • The archaeal pathway contains unique enzymes not found in bacteria, reflecting evolutionary divergence.

The table below summarizes key differences between aerobic and anaerobic pathways, which can help understand archaeal cobalamin biosynthesis:

FeatureAerobic Pathway (P. denitrificans)Anaerobic Pathway (S. Typhimurium, similar to archaeal)
Cobalt insertionLate stageEarly stage
Ring contractionOxygen-dependentOxygen-independent
Key enzymesCobG, CobJCbiH, CbiG
MethylationPrecorrin intermediatesCobalt-precorrin intermediates

What is the structural relationship between CobD and other enzymes in the biosynthetic pathway?

CobD belongs to the aspartate aminotransferase family. Structural studies of S. Typhimurium CobD reveal that the native protein exists as a dimer, with each subunit consisting of large and small domains . The enzyme's structure is particularly similar to histidinol phosphate aminotransferase, suggesting an evolutionary relationship between these enzymes . While the specific structure of M. jannaschii CobD has not been directly determined in the provided search results, its predicted structure would likely reflect thermostability adaptations characteristic of hyperthermophilic archaeal proteins.

What are the optimal expression and purification conditions for recombinant Methanocaldococcus jannaschii CobD?

The expression and purification of recombinant M. jannaschii CobD present unique challenges due to its archaeal origin and thermophilic nature. Based on related cobalamin biosynthesis proteins:

  • Expression System Selection:

    • E. coli BL21(DE3) with pET-based vectors remains the most common expression system

    • Consider codon optimization for archaeal genes to improve expression in E. coli

    • For proper folding, co-expression with archaeal chaperones may be beneficial

  • Induction Conditions:

    • IPTG concentration: 0.1-0.5 mM

    • Induction temperature: 18-25°C for 16-20 hours (lower temperatures often improve folding of archaeal proteins)

  • Purification Strategy:

    • Heat treatment (65-75°C for 15-20 minutes) to exploit thermostability and eliminate E. coli proteins

    • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Size exclusion chromatography for final polishing

  • Buffer Optimization:

    • Higher salt concentrations (300-500 mM NaCl) often stabilize archaeal proteins

    • Consider including glycerol (10-20%) to improve stability

    • pH optimization typically in the range of 7.0-8.0

Note that while related cobalamin biosynthesis proteins like CobS have shown poor expression yields (approximately 0.2 mg/liter of culture) , optimizing these conditions may improve yields for M. jannaschii CobD.

How can enzymatic activity of M. jannaschii CobD be accurately measured and what are the expected kinetic parameters?

Based on the known function of bacterial CobD and related enzymes:

  • Activity Assay Principles:

    • Monitor the decarboxylation of L-threonine-O-3-phosphate to form (R)-1-amino-2-propanol-O-2-phosphate

    • Detect CO₂ release using coupled enzymatic assays or radioisotope methods

    • HPLC or LC-MS/MS can be used to detect the formation of (R)-1-amino-2-propanol-O-2-phosphate

  • Assay Conditions:

    • Elevated temperatures (65-85°C) to reflect the hyperthermophilic nature of M. jannaschii

    • Buffer conditions: typically phosphate or HEPES buffer (50-100 mM), pH 7.0-8.0

    • Include pyridoxal 5'-phosphate (PLP) as a cofactor (typically 50-100 μM)

  • Expected Kinetic Parameters:

    • Optimal temperature likely between 80-90°C (based on M. jannaschii growth conditions)

    • Higher thermal stability compared to bacterial homologs

    • Km values for L-threonine-O-3-phosphate likely in the micromolar range

    • Enhanced catalytic efficiency at higher temperatures

When measuring these parameters, researchers should consider performing thermal shift assays to determine protein stability across a temperature range before conducting activity assays.

What are the most effective heterologous expression systems for functional studies of M. jannaschii CobD?

Several expression systems can be considered for functional studies of M. jannaschii CobD:

  • E. coli-based Systems:

    • pET system with BL21(DE3) or Rosetta(DE3) strains

    • Arctic Express or similar systems designed for difficult-to-express proteins

    • Advantages: Well-established protocols, high yield potential

    • Limitations: Potential folding issues with archaeal proteins

  • Archaeal Expression Systems:

    • Thermococcus kodakarensis or Pyrococcus furiosus-based systems

    • Advantages: Native-like environment, proper folding

    • Limitations: Lower yields, technically challenging

  • Cell-free Expression Systems:

    • PURE system or similar reconstituted translation systems

    • Advantages: Rapid expression, avoid toxicity issues

    • Limitations: Higher cost, smaller scale

  • Yeast Expression:

    • Pichia pastoris for secreted expression

    • Advantages: Post-translational modifications, proper folding

    • Limitations: Longer development time, glycosylation differences

For M. jannaschii CobD, a modified E. coli system with codon optimization and archaeal chaperone co-expression may offer the best balance of yield and functionality, especially when combined with a heat purification step to exploit the thermostability of the target protein.

How can site-directed mutagenesis be utilized to understand the catalytic mechanism of M. jannaschii CobD?

Based on structural information from related CobD proteins:

  • Key Residues for Mutagenesis:

    • Active site residues involved in PLP binding

    • Residues interacting with L-threonine-O-3-phosphate substrate

    • Dimerization interface residues

    • Thermostability-contributing residues

  • Recommended Mutagenesis Strategy:

    • Alanine scanning of conserved residues

    • Conservative substitutions to distinguish between catalytic and structural roles

    • Introduction of thermosensitive mutations to assess thermostability contributions

  • Functional Analysis of Mutants:

    • Thermal stability assays (DSC, thermal shift)

    • Activity assays at various temperatures

    • Substrate binding studies using ITC or SPR

    • Structural analysis of mutants via X-ray crystallography or cryo-EM

The structure of S. Typhimurium CobD reveals it directs the breakdown of the external aldimine complex toward decarboxylation instead of amino transfer . Targeted mutagenesis of corresponding residues in M. jannaschii CobD would help elucidate whether similar mechanisms operate in the archaeal enzyme.

What analytical techniques are most appropriate for detecting intermediates in the M. jannaschii cobalamin biosynthetic pathway?

Several complementary analytical techniques can be employed to study cobalamin biosynthesis intermediates:

  • HPLC Analysis:

    • Reversed-phase HPLC with UV-visible detection (specific wavelengths: 360-370 nm for early intermediates, 350-550 nm for later corrinoids)

    • Size-exclusion HPLC for intact corrinoid analysis

    • Ion-exchange HPLC for phosphorylated intermediates

  • Mass Spectrometry:

    • LC-MS/MS for sensitive detection and structural characterization

    • MALDI-TOF for intact mass analysis

    • High-resolution MS for elemental composition confirmation

  • NMR Spectroscopy:

    • ¹H and ¹³C NMR for structural elucidation

    • ³¹P NMR for phosphorylated intermediates

    • Metal-specific NMR for cobalt-containing intermediates

  • UV-Visible Spectroscopy:

    • Characteristic absorption spectra of different corrinoid intermediates

    • Useful for monitoring reactions in real-time

  • Specific Detection Methods:

    • Bioassays using cobalamin-dependent microorganisms

    • Radioisotope labeling with ⁵⁷Co or ¹⁴C-labeled precursors

When studying the specific intermediates related to CobD function, such as (R)-1-amino-2-propanol-O-2-phosphate, LC-MS/MS with multiple reaction monitoring (MRM) would be particularly valuable for sensitive and specific detection.

How does M. jannaschii CobD compare to homologous proteins from other archaea and bacteria?

Comparative analysis between M. jannaschii CobD and homologs from other organisms reveals important evolutionary and functional insights:

  • Sequence Conservation:

    • M. jannaschii CobD shows significant similarity to CobD in other methanogens

    • Moderate similarity to bacterial CobD proteins (such as from S. Typhimurium)

    • Conserved catalytic residues across domains of life

  • Structural Comparison:

    • All CobD proteins likely belong to the aspartate aminotransferase family

    • S. Typhimurium CobD exists as a dimer with large and small domains

    • Archaeal CobD proteins likely have additional structural elements contributing to thermostability

  • Functional Divergence:

    • All CobD proteins are involved in synthesizing the aminopropanol component for the nucleotide loop assembly

    • Bacterial CobD functions as an L-threonine-O-3-phosphate decarboxylase

    • Archaeal CobD likely retains this core function but may show different substrate specificity or catalytic efficiency

  • Adaptation to Environmental Niches:

    • M. jannaschii CobD likely shows adaptations to high temperature and pressure environments

    • Mesophilic bacterial CobD proteins lack these thermostability features

    • Halophilic archaeal CobD proteins would show additional adaptations to high salt environments

This comparative analysis highlights how CobD has evolved while maintaining its core function across diverse prokaryotic lineages.

What insights can be gained from studying the thermal stability of M. jannaschii CobD for protein engineering applications?

M. jannaschii CobD, being from a hyperthermophilic archaeon that grows optimally at 85°C, offers valuable insights for protein engineering:

  • Structural Features Contributing to Thermostability:

    • Higher proportion of charged amino acids forming ionic networks

    • Increased number of hydrophobic interactions in the protein core

    • Reduction in thermolabile residues (Asn, Gln, Cys, Met)

    • Shorter surface loops and increased helical content

  • Applications in Protein Engineering:

    • Design of thermostable biocatalysts for industrial processes

    • Development of enzymes for high-temperature PCR and other molecular biology applications

    • Creation of stable scaffolds for enzyme immobilization

  • Experimental Approaches:

    • Circular dichroism spectroscopy to monitor thermal denaturation

    • Differential scanning calorimetry for thermodynamic parameters

    • Activity assays at elevated temperatures to assess functional thermostability

    • X-ray crystallography at different temperatures to observe structural changes

  • Comparison with Related Proteins:

    • CobY from M. jannaschii denatures at 80°C with concomitant loss of activity

    • CobD likely shows similar or greater thermostability

    • Comparative analysis with mesophilic homologs can identify key thermostability determinants

Understanding these thermostability features can guide rational design of enzymes for biotechnological applications requiring high-temperature stability.

What are common challenges in expressing recombinant M. jannaschii CobD and how can they be addressed?

Researchers often encounter several challenges when working with recombinant archaeal proteins:

  • Poor Expression Yields:

    • Challenge: Low protein production in heterologous hosts

    • Solution: Codon optimization, use of specialized expression strains (Rosetta, C41/C43), lower induction temperatures (16-20°C)

  • Protein Misfolding:

    • Challenge: Incorrect folding leading to inclusion body formation

    • Solution: Co-expression with archaeal chaperones, fusion with solubility tags (SUMO, MBP), addition of chemical chaperones like proline or betaine to growth media

  • Protein Instability:

    • Challenge: Degradation during expression or purification

    • Solution: Addition of protease inhibitors, optimization of buffer conditions (higher salt, stabilizing additives like glycerol)

  • Loss of Activity:

    • Challenge: Purified protein lacks enzymatic activity

    • Solution: Ensure proper cofactor incorporation (PLP), verify correct oligomeric state, confirm substrate availability and purity

  • Protein Aggregation:

    • Challenge: Aggregation during concentration or storage

    • Solution: Addition of mild detergents, optimization of storage buffer, flash-freezing in small aliquots

Many cobalamin biosynthesis proteins present expression challenges - for example, CobS can only be isolated in small amounts (~0.2 mg/liter of culture) . Similar challenges may be encountered with M. jannaschii CobD and require systematic optimization of expression and purification conditions.

How can researchers overcome difficulties in reconstituting the cobalamin biosynthetic pathway for in vitro studies involving M. jannaschii CobD?

In vitro reconstitution of cobalamin biosynthesis presents significant challenges that can be addressed through systematic approaches:

  • Substrate Availability:

    • Challenge: Limited commercial availability of pathway intermediates

    • Solution: Chemical synthesis of key intermediates or isolation from engineered strains accumulating specific compounds

  • Multi-enzyme System Complexity:

    • Challenge: Need for multiple purified enzymes functioning in concert

    • Solution: Stepwise reconstitution focusing on specific segments of the pathway, cell-free expression systems containing multiple enzymes

  • Anaerobic Conditions:

    • Challenge: Oxygen sensitivity of intermediates and enzymes

    • Solution: Use of anaerobic chambers, oxygen-scavenging systems, and proper handling techniques

  • Thermophilic Conditions:

    • Challenge: Need for high-temperature assays matching M. jannaschii physiology

    • Solution: Specialized equipment for high-temperature reactions, thermostable buffer systems, consideration of pressure effects

  • Detection Sensitivity:

    • Challenge: Low concentrations of intermediates

    • Solution: Development of highly sensitive analytical methods, use of radioactive tracers, fluorescent labeling strategies

A step-by-step approach focusing first on the reactions immediately surrounding CobD function (conversion of cobyric acid to cobinamide) before expanding to broader pathway reconstitution would be most practical for researchers.

What are promising applications of engineered M. jannaschii CobD variants in synthetic biology?

Engineered variants of M. jannaschii CobD could contribute to several synthetic biology applications:

  • Enhanced Cobalamin Production:

    • Development of thermostable CobD variants with improved catalytic efficiency

    • Integration into synthetic pathways for vitamin B12 production

    • Creation of cobamide analogs with modified structures for specialized applications

  • Novel Biocatalytic Applications:

    • Engineering CobD for broader substrate specificity to generate novel aminoalcohol derivatives

    • Development of enzyme cascades involving CobD for stereoselective synthesis

    • Creation of bifunctional enzymes combining CobD activity with other pathway functions

  • Biosensor Development:

    • Engineering CobD-based biosensors for detection of pathway intermediates

    • Development of thermal-stable biosensors for extreme environments

    • Creation of whole-cell biosensors for vitamin B12 pathway manipulation

  • Minimal Cell Applications:

    • Inclusion of optimized CobD in minimal synthetic cells capable of cobalamin synthesis

    • Development of simplified cobalamin pathways with reduced genetic requirements

    • Investigation of cobalamin biosynthesis as a model for complex pathway engineering

These applications would benefit from detailed structural studies of M. jannaschii CobD combined with directed evolution approaches to generate variants with desired properties.

How might systems biology approaches enhance our understanding of M. jannaschii cobalamin biosynthesis regulation?

Systems biology approaches offer powerful tools for understanding complex metabolic pathways like cobalamin biosynthesis:

  • Multi-omics Integration:

    • Combining transcriptomics, proteomics, and metabolomics data to create comprehensive pathway models

    • Identifying regulatory hubs controlling cobD expression and function

    • Mapping the interaction between cobalamin biosynthesis and other cellular processes

  • Metabolic Flux Analysis:

    • Quantifying metabolite flow through the cobalamin biosynthetic pathway

    • Identifying rate-limiting steps that could be engineering targets

    • Understanding how environmental factors affect pathway flux

  • Regulatory Network Modeling:

    • Computational modeling of gene regulatory networks controlling cobD expression

    • Identification of transcription factors and small RNA regulators

    • Prediction of pathway behavior under different environmental conditions

  • Comparative Systems Analysis:

    • Cross-species comparison of cobalamin biosynthesis regulation

    • Identification of conserved and divergent regulatory mechanisms

    • Evolutionary analysis of pathway optimization

  • Synthetic Circuit Design:

    • Development of synthetic regulatory circuits for controlled expression of cobD and related genes

    • Creation of feedback-regulated systems optimizing cobalamin production

    • Testing of minimal regulatory architectures supporting pathway function

Such approaches would address the current lack of understanding regarding how archaeal cobalamin biosynthesis is regulated in response to environmental factors, nutrient availability, and cellular energy status.

What are the most significant recent advances in understanding archaeal cobalamin biosynthesis proteins like M. jannaschii CobD?

Recent advances in understanding archaeal cobalamin biosynthesis have expanded our knowledge in several key areas:

  • Structural Insights:

    • Determination of crystal structures for key enzymes in the pathway

    • Elucidation of enzyme mechanisms through structural and biochemical approaches

    • Understanding of how archaeal enzymes adapt to extreme conditions

  • Pathway Regulation:

    • Identification of regulatory mechanisms controlling cobalamin biosynthesis

    • Discovery of the relationship between cobalamin synthesis and other metabolic pathways

    • Understanding of cobalt uptake and incorporation systems

  • Evolutionary Perspectives:

    • Clarification of the evolutionary relationships between aerobic and anaerobic pathways

    • Identification of non-orthologous replacements like CobY in archaea

    • Understanding horizontal gene transfer events shaping cobalamin biosynthesis

  • Technological Developments:

    • Improved methods for heterologous expression of archaeal proteins

    • Enhanced analytical techniques for detecting pathway intermediates

    • Development of genetic tools for manipulating archaeal metabolism

These advances collectively improve our understanding of how ancient metabolic pathways like cobalamin biosynthesis function in extremophilic organisms and provide insights into the evolution and adaptation of essential cofactor synthesis pathways.

How does research on M. jannaschii CobD contribute to our broader understanding of archaeal metabolism and evolution?

Research on M. jannaschii CobD contributes to several broader scientific questions:

  • Archaeal Metabolic Diversity:

    • Illuminates unique aspects of cofactor biosynthesis in archaea

    • Contributes to understanding methanogenesis-related metabolism

    • Helps define the metabolic capabilities of thermophilic archaea

  • Evolutionary Insights:

    • Clarifies the evolutionary history of cobalamin biosynthesis across domains of life

    • Provides evidence for ancient origin of vitamin B12 dependency

    • Illustrates enzyme evolution under extreme environmental pressure

  • Adaptations to Extreme Environments:

    • Demonstrates biochemical adaptations to high temperature and pressure

    • Reveals mechanisms of protein thermostability

    • Provides insights into enzyme function under extreme conditions

  • Origins of Life Research:

    • Contributes to understanding early metabolic pathways on Earth

    • Illuminates the evolution of complex cofactor biosynthesis

    • Supports models of metabolic pathway development in early life forms

  • Astrobiology Applications:

    • Informs searches for potential biochemical signatures in extraterrestrial environments

    • Provides models for potential metabolism in extreme environments beyond Earth

    • Contributes to understanding the limits of life in the universe

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.