Recombinant Methanocaldococcus jannaschii Probable phosphate transport system permease protein pstC (pstC)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant PstC is a full-length, His-tagged permease protein expressed in Escherichia coli for structural and functional studies. It belongs to the phosphate-specific transport (Pst) system, which facilitates phosphate acquisition in M. jannaschii, a hyperthermophilic methanogen isolated from hydrothermal vents . The protein is encoded by the pstC gene (locus tag: MJ1014) and is annotated as a probable permease component of the ABC transporter complex .

Biological Role

  • Phosphate Transport: PstC is a permease subunit of the ABC transporter complex, enabling high-affinity phosphate uptake under low-phosphate conditions .

  • Thermostability: Inherits stability from M. jannaschii, an organism thriving at 80°C, making it suitable for high-temperature biochemical assays .

Expression and Purification

  • Vector System: Cloned into E. coli expression vectors with codon optimization for rare tRNA genes .

  • Purification: Immobilized metal-affinity chromatography (IMAC) leveraging the His tag .

  • Reconstitution: Recommended in Tris/PBS buffer with 6% trehalose (pH 8.0); glycerol (5–50%) enhances long-term stability .

Quality Metrics

  • Purity: Validated by SDS-PAGE (>90%) .

  • Activity: Functional assays pending publication, but structural homology suggests ATP-dependent phosphate transport .

Current and Potential Uses

Application AreaUtility
Structural BiologyCrystal structure determination of archaeal ABC transporters .
Thermostability StudiesInvestigating protein stability mechanisms in extremophiles .
BiotechnologyEngineering heat-stable phosphate sensors or industrial enzymes .

Challenges

  • Limited in vivo validation due to M. jannaschii’s genetic intractability .

  • No peer-reviewed functional assays specific to recombinant PstC are published yet .

Comparative Analysis with Homologs

FeatureM. jannaschii PstC E. coli PstC
Length315 aa319 aa
ThermostabilityHigh (80°C-tolerant)Moderate (37°C-optimized)
Expression Yield0.1–1.0 mg/mL Higher yields reported

Future Directions

  • Genetic Knockout Models: Leveraging emerging CRISPR tools for M. jannaschii to validate PstC’s role in phosphate metabolism .

  • Proteomic Studies: Identifying interaction partners via affinity tagging .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pstC; MJ1014; Probable phosphate transport system permease protein PstC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
pstC
Target Protein Sequence
MKTMEIKKLLRKIDEFKIITLPAIFVVFILFVLILGFYFFNALPAIERYGIDLFITNVWK AAEEPAKEVYGLAAPIWGSIYTATIAVLIALPLSICYAIFVNDYAPKRLKYPLIVISDIM AGLPTIIYGIWGAFILVPLLRDHIMKFLYEHFSFIPLFDYPPLSGYCYLSAGILLGIMVT PFAAAIIREAYAMIPSVYKEGLVALGATRYETTKVLIKYIRPAIISGLILAFGRALGETV AVSLVIGNSFNLTYKLFAPGYTISSLIANQFGNAVLYEYMTSVLYSAGLVLFVIGLVVNI IGIYYLKRWREHVSH
Uniprot No.

Target Background

Function
This protein is a component of the binding-protein-dependent transport system for phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: mja:MJ_1014

STRING: 243232.MJ_1014

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the phosphate transport system function in archaeal organisms compared to bacterial systems?

The phosphate transport system in archaeal organisms like M. jannaschii shares structural similarities with bacterial systems such as E. coli's Pst system while having distinct adaptations for extreme environments. In E. coli, the Pst system is a periplasmic phosphate permease with two hydrophobic subunits (PstA and PstC) containing critical proline residues in transmembrane helices 3 and 4 .

While specific data on M. jannaschii's phosphate transport is limited in the provided sources, comparative analysis suggests archaeal phosphate permeases like PstC likely maintain similar functional domains but with increased thermostability. The archaeal PstC proteins would require specialized arrangements of charged residues and proline positions to maintain structural integrity at high temperatures while still facilitating phosphate transport. Research indicates that substitutions of key proline residues can dramatically affect transport functionality, with some mutations resulting in permanently "open" or "closed" transport systems .

What methods are available for cloning and expressing M. jannaschii genes in laboratory settings?

For cloning and expressing M. jannaschii genes, researchers can follow these methodological approaches:

  • Genomic DNA extraction and amplification:

    • Obtain M. jannaschii genomic DNA from repositories like American Type Culture Collection

    • Design specific primers for the target gene (e.g., pstC)

    • Amplify using PCR with high-fidelity polymerases like Pfu turbo

    • Use optimized conditions: typically 51°C annealing temperature, 30 seconds per cycle for 32 cycles

  • Vector selection and insertion:

    • Digest PCR products with appropriate restriction enzymes (commonly NdeI and XhoI)

    • Insert into expression vectors such as pet22b+ for E. coli expression systems

    • Consider C-terminal His-tagging for simplified purification

  • Optimized expression conditions:

    • Apply statistical experimental design methodologies to identify optimal expression parameters

    • Consider multivariant analysis rather than traditional univariant approaches

    • Focus on variables affecting soluble protein expression including temperature, inducer concentration, and media composition

The recent breakthrough in developing a genetic system specifically for M. jannaschii now allows direct genomic manipulation, enabling researchers to add or remove genes directly in this organism rather than relying solely on heterologous expression systems .

What are the typical structural features of archaeal membrane proteins like PstC?

Archaeal membrane proteins like PstC display distinctive structural features adapted to extreme environments:

  • Transmembrane topology: Typically contains multiple transmembrane helices (approximately 6-8 in permease proteins) that span the cell membrane, with proline residues often creating strategic kinks in these helices that are crucial for transport function .

  • Conserved domains: Contains substrate-binding domains and channel-forming regions similar to those found in bacterial counterparts but with thermostable adaptations.

  • Charged residue distribution: Strategic positioning of charged residues (like R237 and E241 observed in E. coli PstC) that form salt bridges essential for maintaining structure and function in extreme conditions .

  • Post-translational modifications: May contain unique archaeal-specific modifications that contribute to protein stability at high temperatures.

  • Lipid interactions: Specialized interactions with archaeal membrane lipids, which differ fundamentally from bacterial lipids in having ether linkages rather than ester linkages to glycerol.

The structural integrity of these features is paramount for phosphate transport functionality, as demonstrated by mutagenesis studies showing that alterations to proline residues can result in permanently "open" or "closed" transport configurations .

What experimental design strategies optimize soluble expression of recombinant M. jannaschii PstC protein?

Optimizing soluble expression of recombinant M. jannaschii PstC requires sophisticated experimental design strategies:

Table 1: Key Variables and Their Effects on Soluble Expression of Archaeal Membrane Proteins

VariableRecommended RangeEffect on Soluble ExpressionStatistical Significance
Temperature16-30°CLower temperatures typically increase solubilityHigh (p<0.01)
IPTG concentration0.1-1.0 mMOptimal at lower concentrations for membrane proteinsMedium (p<0.05)
Growth mediaLB, TB, M9Rich media favors biomass but may increase inclusion bodiesMedium (p<0.05)
Expression duration4-24 hoursShorter for thermostable proteinsHigh (p<0.01)
AdditivesGlycerol, arginine, sucroseStabilizes protein foldingVariable

Implementing factorial design approaches is crucial for systematically evaluating these variables. Unlike traditional univariant methods, multivariant factorial designs allow researchers to:

  • Identify statistically significant variables affecting expression

  • Detect interactions between variables that might be missed in one-factor-at-a-time approaches

  • Characterize experimental error systematically

  • Compare variable effects when normalized

  • Gather high-quality data with minimal experimental runs

For membrane proteins like PstC, consider supplementing with specific detergents during lysis and purification stages. Based on successful approaches with other archaeal membrane proteins, a progressive detergent screening strategy starting with milder detergents (DDM, LDAO) before attempting stronger solubilizers (SDS, sarkosyl) may preserve structural integrity while maximizing yield .

How do mutations in conserved proline residues affect the structure and function of archaeal PstC compared to bacterial homologs?

Mutations in conserved proline residues significantly impact PstC structure and function, with distinct effects in archaeal versus bacterial systems:

  • Conformational impact:

    • Proline residues in transmembrane helices 3 and 4 create critical kinks that facilitate conformational changes during transport

    • In bacterial PstC, substituting these prolines with leucine results in complete loss of phosphate transport activity

    • Substitution with alanine produces only partial functional loss

  • Paired mutations:

    • Double mutations produce dramatically different effects depending on protein context

    • In bacterial PstA protein, double proline-to-alanine mutations result in permanently "closed" systems

    • In bacterial PstC protein, similar double mutations create permanently "open" transport systems

For archaeal PstC from M. jannaschii, these effects are likely amplified due to the extreme conditions in which the protein functions. The thermostability requirements would make proline positioning even more critical, as these residues limit backbone flexibility and stabilize secondary structures at high temperatures.

Research suggests archaeal transporters may have evolved unique proline arrangements that balance structural rigidity (needed for thermal stability) with the flexibility required for substrate transport. Investigation of these residues presents an opportunity to elucidate fundamental differences in membrane protein dynamics between domains of life.

What are the recommended approaches for resolving protein purification challenges specific to recombinant M. jannaschii PstC?

Purifying recombinant M. jannaschii PstC presents unique challenges requiring specialized approaches:

  • Initial consideration of expression system:

    • E. coli systems require optimization for thermostable archaeal proteins

    • C-terminal His-tagging shows higher success rates than N-terminal tags for membrane proteins

    • Consider specialized E. coli strains with enhanced membrane protein expression capacity (e.g., C41/C43)

  • Membrane protein extraction protocol:

    • Gentle cell lysis using French press or sonication with cooling intervals

    • Membrane fraction isolation via ultracentrifugation (typically 100,000×g for 1 hour)

    • Sequential detergent extraction starting with milder detergents (0.5-2% DDM or LDAO)

  • Chromatography optimization:

    • IMAC (Immobilized Metal Affinity Chromatography) with detergent in all buffers

    • Consider on-column refolding for inclusion body recovery

    • Size exclusion chromatography for oligomeric state verification

  • Functional assessment validation:

    • Develop phosphate transport assays adaptable to detergent-solubilized protein

    • Consider reconstitution into liposomes for functional studies

    • Thermal stability assays to confirm retention of thermophilic properties

Successful purification strategies from similar archaeal membrane proteins suggest that a three-phase approach (optimization of expression, careful membrane extraction, and multi-step chromatography) can achieve up to 75% homogeneity while maintaining protein functionality .

How can researchers effectively design experiments to investigate the evolutionary relationship between archaeal and bacterial phosphate transport systems?

Designing experiments to investigate evolutionary relationships between archaeal and bacterial phosphate transport systems requires multi-faceted approaches:

  • Comparative genomic analysis:

    • Construct comprehensive phylogenetic trees using PstC sequences from diverse archaea, bacteria, and when available, eukaryotes

    • Identify conserved motifs across domains using tools like MEME and HMMER

    • Calculate selection pressures (dN/dS ratios) on different protein regions to identify functionally critical domains

  • Structure-function relationship investigation:

    • Design chimeric proteins combining domains from archaeal and bacterial PstC

    • Create targeted mutations at conserved residues identified through sequence alignment

    • Assess functional conservation through complementation studies in phosphate transport-deficient strains

  • Ancestral sequence reconstruction:

    • Apply maximum likelihood methods to infer ancestral PstC sequences

    • Express reconstructed ancestral proteins to test functionality under various conditions

    • Compare biochemical properties of ancestral and extant proteins to trace evolutionary adaptations

  • Experimental evolution approaches:

    • Subject M. jannaschii to prolonged phosphate limitation to observe adaptations

    • Sequence evolved strains to identify mutations in pstC and related genes

    • Correlate genetic changes with functional adaptations

The recently developed genetic system for M. jannaschii provides unprecedented opportunities for direct genetic manipulation of this archaeon, allowing researchers to test evolutionary hypotheses directly in this ancient lineage rather than relying solely on heterologous systems .

What techniques are most effective for analyzing the stability and functionality of recombinant archaeal PstC under varying temperature and pressure conditions?

Analyzing stability and functionality of recombinant archaeal PstC under extreme conditions requires specialized techniques:

Table 2: Techniques for Analyzing Archaeal Membrane Protein Stability and Function

TechniqueParameter MeasuredAdvantagesLimitations
Circular Dichroism (CD) SpectroscopySecondary structure retentionReal-time thermal unfolding profilesLimited by detergent interference
Differential Scanning Calorimetry (DSC)Thermal transition pointsQuantitative thermodynamic parametersRequires larger protein quantities
High-Pressure Light ScatteringAggregation behavior under pressureDirect measurement of pressure effectsSpecialized equipment required
Reconstituted Liposome AssaysTransport functionalityClosest to native environmentComplex preparation procedure
Hydrogen-Deuterium Exchange Mass SpectrometryRegional stability differencesDetailed structural dynamics informationData analysis complexity

For archaeal PstC specifically, implementing temperature-controlled transport assays using reconstituted proteoliposomes provides the most physiologically relevant data. These assays can be performed by:

  • Reconstituting purified PstC into liposomes composed of archaeal lipid extracts or synthetic lipids mimicking archaeal membranes

  • Loading liposomes with fluorescent phosphate analogs

  • Monitoring transport activity at temperature ranges from 25°C to 95°C

  • Using pressure chambers to simulate deep-sea conditions (up to 260 atmospheres)

This approach allows direct quantification of how temperature and pressure affect transport kinetics, offering insights into the molecular adaptations that allow M. jannaschii PstC to function in extreme hydrothermal vent environments .

How can insights from M. jannaschii PstC structure and function contribute to designing thermostable proteins for biotechnological applications?

The study of M. jannaschii PstC offers valuable insights for designing thermostable proteins with applications in biotechnology:

  • Identification of stabilizing motifs:

    • Analysis of M. jannaschii PstC can reveal specific amino acid arrangements that confer thermostability

    • These motifs can be transferred to mesophilic proteins to enhance their thermal resistance

    • The placement of strategic proline residues, as observed in transmembrane helices, can be particularly valuable for stabilizing membrane proteins

  • Understanding ion-pair networks:

    • M. jannaschii proteins typically display extensive networks of ion-pairs that maintain structure at high temperatures

    • Mapping these networks in PstC can provide templates for engineering similar networks in other proteins

    • The specific charged residues (like those analogous to R237 and E241 in bacterial PstC) can guide rational design approaches

  • Applications in membrane protein engineering:

    • Thermostable membrane proteins are valuable as scaffolds for biosensors and biocatalysts

    • M. jannaschii PstC design principles can inform the development of stable membrane protein expression systems

    • Engineered variants can serve as robust templates for structural studies of challenging membrane proteins

These insights are particularly relevant for developing technologies requiring operation at elevated temperatures, such as high-temperature bioreactors, thermostable biosensors, and enzymes for industrial applications requiring reduced cooling costs.

What approaches can be used to investigate the interplay between PstC and other components of the phosphate transport system in M. jannaschii?

Investigating interactions between PstC and other phosphate transport components requires multi-disciplinary approaches:

  • Co-immunoprecipitation studies:

    • Express tagged versions of PstC and other putative interaction partners

    • Perform pulldown assays under varying phosphate concentrations

    • Identify interaction dynamics using quantitative proteomics

  • Bacterial/archaeal two-hybrid systems:

    • Adapt two-hybrid technologies for thermophilic organisms

    • Screen for interactions between PstC and other components like PstA, PstB, and PhoU

    • Map interaction domains through truncation analysis

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinking to stabilize transient protein-protein interactions

    • Identify crosslinked peptides using high-resolution mass spectrometry

    • Generate interaction maps of the complete phosphate transport complex

  • Genetic complementation studies:

    • Utilizing the newly developed genetic system for M. jannaschii

    • Create knockout strains for individual components and assess phenotypes

    • Perform cross-species complementation to identify functional conservation

  • Cryo-electron microscopy:

    • Purify intact phosphate transport complexes for structural analysis

    • Generate 3D reconstructions of the complete transport system

    • Identify conformational changes associated with transport cycle

These approaches collectively would provide comprehensive insights into how PstC functions within the broader context of phosphate acquisition in extremophilic archaea.

What are the optimal strategies for developing inducible gene expression systems for controlled production of recombinant M. jannaschii PstC?

Developing inducible expression systems for M. jannaschii PstC requires careful consideration of several factors:

Table 3: Comparison of Expression Systems for Archaeal Membrane Proteins

Expression SystemInduction MethodAdvantagesLimitationsYield Potential
pET (E. coli)IPTGWell-established protocolsInclusion body formationModerate to high
pBAD (E. coli)ArabinoseTight regulation, concentration-dependentCatabolite repression issuesModerate
Cold-shock (E. coli)Temperature shiftEnhanced solubilitySlower growth rateLow to moderate
Archaeal nativeVariousNative folding environmentComplex cultivation requirementsLow

For optimal results with M. jannaschii PstC, a factorial design optimization approach is strongly recommended . This involves:

  • Systematic testing of key variables:

    • Inducer concentration (0.01-1.0 mM IPTG or 0.002-0.2% arabinose)

    • Temperature (16-37°C)

    • Media composition (minimal vs. rich)

    • Host strain (BL21, C41/C43, Rosetta)

    • Induction timing (early, mid, or late log phase)

  • Fusion partner evaluation:

    • MBP (maltose-binding protein) for enhanced solubility

    • SUMO for improved folding and cleavable purification

    • Thermostable proteins like thioredoxin from thermophiles

  • Co-expression strategies:

    • Chaperones (GroEL/ES, DnaK/J)

    • Rare tRNAs for archaeal codon bias

    • Other components of the phosphate transport system

The multivariant analysis approach, rather than traditional one-variable-at-a-time methods, allows identification of interaction effects between variables and optimization with fewer experiments . For example, lower temperatures might require higher inducer concentrations, relationships that would be missed in univariate approaches.

What are the key unresolved questions regarding M. jannaschii PstC and how might they be addressed in future research?

Several critical questions about M. jannaschii PstC remain unresolved and warrant focused investigation:

  • Structural determinants of thermostability:

    • How does PstC maintain functional flexibility while ensuring structural integrity at extreme temperatures?

    • What specific amino acid arrangements contribute to its remarkable stability?

    • Future approaches: Obtain high-resolution structures through cryo-EM or X-ray crystallography; perform systematic mutagenesis of conserved residues

  • Transport mechanism under extreme conditions:

    • How does pressure affect phosphate transport kinetics in deep-sea environments?

    • Does M. jannaschii PstC employ unique transport mechanisms compared to mesophilic homologs?

    • Future approaches: Develop pressurized transport assays; compare transport rates across temperature and pressure gradients

  • Regulatory networks:

    • How is pstC expression regulated in response to phosphate availability?

    • What sensing mechanisms operate in M. jannaschii to detect phosphate limitation?

    • Future approaches: Transcriptomics and proteomics under varying phosphate conditions; ChIP-seq to identify regulatory elements

  • Evolutionary adaptation:

    • How has PstC evolved to function in hydrothermal vent environments?

    • What ancestral features have been conserved from LUCA (Last Universal Common Ancestor)?

    • Future approaches: Comparative genomics across extremophiles; ancestral sequence reconstruction; experimental evolution studies

The recent development of a genetic system for M. jannaschii represents a significant breakthrough that will accelerate progress in addressing these questions by enabling direct genetic manipulation of this organism . This system allows for genome editing, gene deletion, and controlled expression studies directly in M. jannaschii rather than relying solely on heterologous systems.

How might research on M. jannaschii PstC contribute to our understanding of early Earth biology and the evolution of nutrient transport systems?

Research on M. jannaschii PstC offers a unique window into early Earth biology and transport system evolution:

  • Ancient metabolic processes:

    • M. jannaschii performs respiratory metabolism estimated to be approximately 3.5 billion years old

    • Understanding its phosphate acquisition mechanisms provides insights into nutrient cycling in early Earth environments

    • The functional constraints on PstC likely reflect ancient selective pressures that shaped early cellular evolution

  • Adaptation to primitive Earth conditions:

    • Hydrothermal vents represent environments similar to those that existed on early Earth

    • M. jannaschii's adaptations for phosphate acquisition under extreme conditions may mirror early evolutionary innovations

    • Comparison with bacterial systems can identify conserved ancestral features versus domain-specific adaptations

  • Implications for astrobiology:

    • The mechanisms enabling M. jannaschii to acquire essential nutrients in extreme environments inform the search for life in extraterrestrial settings

    • Understanding the minimal requirements for phosphate transport helps define parameters for potential habitable environments beyond Earth

  • Evolutionary implications:

    • Comparative genomics between archaeal and bacterial phosphate transporters can reveal whether these systems evolved independently or diverged from a common ancestor

    • Identifying the core functional elements conserved across all domains provides insights into the minimal requirements for phosphate transport

This research contributes to our fundamental understanding of how essential cellular processes evolved and adapted across billions of years, potentially revealing principles that shaped all life on Earth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.