Recombinant Methanocaldococcus jannaschii Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Functional Role in Protein Quality Control

HtpX is an integral membrane metallopeptidase that degrades misfolded membrane proteins, preventing their accumulation . Key functional insights:

  • Mechanism: Utilizes a catalytic water molecule activated by zinc coordination to hydrolyze peptide bonds .

  • Proteasome Interaction: Works alongside the PAN-proteasome system (e.g., PAN complex MJ1176) in M. jannaschii to unfold and degrade substrates .

  • Substrate Specificity: Preferentially cleaves hydrophobic regions of misfolded membrane proteins .

Recombinant Production and Purification

Expression in Escherichia coli (e.g., BL21(DE3) strain) achieves high yields (~5 mg/L) :

  1. Construct Design: Catalytically inactive mutants (e.g., E140A) prevent self-degradation .

  2. Membrane Extraction: Octyl-β-D-glucoside solubilizes HtpX from E. coli membranes .

  3. Purification Steps:

    • Cobalt-affinity chromatography (His-tag).

    • Anion-exchange chromatography.

    • Size-exclusion chromatography .

Table 1: Key Studies on HtpX

Study FocusFindingsSource
Catalytic MechanismE140A mutation stabilizes HtpX without altering substrate-binding capacity.
Proteasome SynergyPAN complex (MJ1176) enhances ATP-dependent proteolysis by HtpX.
Archaeal Protease DiversityHtpX is conserved across Euryarchaeota and TACK archaea.

Industrial and Research Relevance

  • Structural Biology: Milligram-scale production enables cryo-EM and crystallography studies .

  • Biotechnology: Serves as a model for engineering thermostable proteases.

  • Evolutionary Insights: Conservation across archaea highlights its role in extremophile adaptation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; MJ1682; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
htpX
Target Protein Sequence
MINQIKTYLLMALLVGLIYAICMMLHIHPLIAIILALIPNVIAYYMSDKLVLMSYNARIL EEHEMPWLHQMVERVARKAGLPKPKVAIVPTETPNAFATGRNPENAVVAVTEGILKLLSP EELEGVIGHEISHIKHRDILISTIVATLAGAIVMIAEWMLYWGGIFFVSEEEESNPLELI GTILLLILAPIAATIIQFAISRQREFYADEEGAKLTHPLWLANALAKLERGVELYPLERG NPATAHMFIINPFRKDFIAKLFSTHPPTEERIERLLEMCKRIGK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1682

STRING: 243232.MJ_1682

Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is HtpX protease and its presumed function in M. jannaschii?

HtpX is an integral membrane metallopeptidase that plays a critical role in protein quality control by preventing the accumulation of misfolded proteins in the membrane . In M. jannaschii, a hyperthermophilic methanogen, HtpX likely functions similarly to maintain membrane protein homeostasis under extreme growth conditions. The presence of the characteristic HEXXH zinc-binding motif indicates its classification as a zinc-dependent metallopeptidase, with catalytic activity dependent on zinc coordination .

How does M. jannaschii HtpX compare to other archaeal homologs?

M. jannaschii is closely related to other archaeal species that express HtpX homologs, though with notable variations in protein length:

Archaeal SpeciesHtpX Homolog Length (residues)UniProt Access Code
Methanopyrus kandleri318Q8TYX0
Methanosarcina acetivorans294Q8TP15
Pyrococcus furiosus289Q8U1S0

Interestingly, while most methanogens possess HtpX homologs, Methanopyrus kandleri AV19, a hydrothermal vent-associated hyperthermophilic methanogen with an optimum growth temperature of 98°C, appears to lack recognizable homologs of thioredoxin (Trx), which might indicate alternative protein quality control mechanisms in this organism .

Why is studying M. jannaschii HtpX significant for archaeal research?

M. jannaschii represents a deeply rooted hyperthermophilic methanogen that grows only on H₂ plus CO₂ . Understanding its protein quality control systems provides valuable insights into how primitive life forms maintain cellular integrity under extreme conditions. Additionally, studying archaeal proteases like HtpX helps bridge knowledge gaps between bacterial and eukaryotic protein quality control systems, potentially revealing evolutionary adaptations specific to extremophiles.

What expression systems are most effective for recombinant M. jannaschii HtpX?

Based on successful expression of other HtpX proteins, the following systems have proven effective:

Expression ParameterRecommended Approach
E. coli strainBL21(DE3) for highest yield
Growth mediumTerrific Broth (TB) supplemented with appropriate antibiotic
Induction conditions0.2-1 mM IPTG at OD600 of 0.5-1.0
Post-induction incubationEither 5h at 37°C or overnight at 18°C
Vector systempET-derived vectors with C-terminal His-tag
Antibiotic resistanceKanamycin (30 μg/ml)

When expressing archaeal proteins in E. coli, lower post-induction temperatures (18°C) often improve proper folding despite slower expression rates.

What strategies prevent self-cleavage during purification of recombinant HtpX?

Wild-type HtpX undergoes rapid self-cleavage after homologous recombinant overexpression during cell disruption and/or membrane solubilization with detergent . To obtain stable protein for structural and functional studies:

  • Create a catalytically ablated mutant through site-directed mutagenesis:

    • E140A mutation (in the zinc-binding motif) prevents self-cleavage while maintaining correct active-site architecture and zinc coordination

    • This generates stable, catalytically inactive protein variants that remain structurally valid for studies

    • Alternative approach: H139F mutation disrupts the active site by preventing zinc coordination

  • Optimal purification strategy:

    • Extract protein from membranes using octyl-β-D-glucoside rather than denaturing agents

    • Purify using three consecutive steps: cobalt-affinity, anion-exchange, and size-exclusion chromatography

    • Maintain detergent throughout purification to preserve native-like membrane protein conformation

How can membrane extraction and solubilization be optimized for M. jannaschii HtpX?

As an integral membrane protein with four predicted transmembrane segments, successful extraction requires:

  • Efficient membrane isolation from expression host

  • Careful detergent selection - octyl-β-D-glucoside has been successfully used for HtpX extraction

  • Maintenance of protein stability during extraction:

    • Consider using protease inhibitors to prevent degradation

    • Perform extraction at low temperatures (4°C)

    • For thermophilic proteins like those from M. jannaschii, mild heat treatment of membrane fractions may help remove less stable E. coli proteins

Successful extraction can be confirmed by Western blotting using anti-His-tag antibodies, with properly extracted HtpX showing activity when the wild-type form is used .

What is known about the structural organization of HtpX proteases?

HtpX proteases exhibit a distinctive structural organization:

  • Transmembrane topology:

    • Four predicted transmembrane segments

    • Two segments typically within the first 55 residues

    • Two additional segments between residues 150-215

    • The catalytic domain positioned on the cytosolic side of the membrane

  • Active site architecture:

    • Characteristic HEXXH zinc-binding motif

    • H139 and H143 (in E. coli numbering) coordinate the catalytic zinc ion

    • A third residue, likely E222, located within a "glutamate helix" spanning residues 220-230, completes zinc coordination

    • E140 functions as a general base/acid during catalysis by aligning and activating the catalytic water molecule

Crystal structure information for complete HtpX is limited, though a structure exists for a soluble fragment of an HtpX ortholog from Vibrio parahaemolyticus (PDB entry 3CQB) .

What experimental approaches are recommended for structural studies of M. jannaschii HtpX?

For structural characterization of this challenging integral membrane protein:

  • X-ray crystallography preparation:

    • Express E140A mutant to prevent self-cleavage

    • Solubilize with octyl-β-D-glucoside and purify to homogeneity

    • Screen various detergents for crystallization trials

    • Consider lipidic cubic phase (LCP) crystallization for membrane proteins

  • Cryo-electron microscopy:

    • Particularly suitable for membrane proteins where crystallization is challenging

    • Reconstitute purified protein into nanodiscs or amphipols to maintain native-like environment

    • May capture different conformational states relevant to catalytic cycle

  • Computational approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations to understand membrane interactions

    • Bioinformatic analysis of sequence conservation in thermophilic variants

How does the active site of HtpX compare to other metallopeptidases?

While HtpX shares the HEXXH zinc-binding motif common to metallopeptidases, it has distinct characteristics:

  • The exact motif in HtpX may deviate from the classical C-G-P-C found in other proteins

  • Unlike some metallopeptidases, HtpX's catalytic domain appears restricted to the cytosolic side of the membrane

  • HtpX appears to cleave only cytoplasmic regions of membrane proteins in vivo , contrasting with other IMMPs like Oma1 that can cleave substrates on both sides of membranes

Mutation studies confirm the importance of E140 and the glutamate residue (E222) in the "glutamate helix" for proper zinc coordination and catalytic activity .

What experimental designs best elucidate substrate specificity of M. jannaschii HtpX?

To determine the substrate specificity of M. jannaschii HtpX:

  • In vitro cleavage assays:

    • Purify wild-type HtpX and potential membrane protein substrates

    • Perform cleavage reactions at elevated temperatures (65-85°C) to mimic M. jannaschii's native environment

    • Analyze cleavage products by SDS-PAGE and mass spectrometry to identify cleavage sites

  • Comparative substrate analysis:

    • Test whether M. jannaschii HtpX can cleave established substrates of E. coli HtpX, such as SecY

    • Compare activity against substrates from different temperature ranges to assess thermophilic adaptations

    • Analyze cleavage efficiency at different temperatures to establish temperature-activity profile

  • Mutagenesis studies:

    • Introduce mutations to potential substrate recognition sites

    • Create substrate variants with altered potential cleavage sites

    • Compare wild-type and E140A (catalytically inactive) binding to substrates to distinguish binding from cleavage

How can researchers investigate the role of HtpX in protein quality control within M. jannaschii?

Investigating HtpX's protein quality control function in M. jannaschii requires several approaches:

  • Stress response analysis:

    • Expose M. jannaschii cultures to varied stressors (heat shock, oxidative stress)

    • Measure HtpX expression levels under different stress conditions

    • Analyze accumulation of misfolded membrane proteins in the presence/absence of functional HtpX

  • Interaction with other quality control components:

    • Investigate potential functional overlap with other proteases

    • Analyze thioredoxin (Trx) system interactions, as M. jannaschii carries two Trx homologs (Trx1 and Trx2)

    • Identify whether Trx-reduced proteins might be substrates or regulators of HtpX

  • Protein-protein interaction studies:

    • Use pull-down assays with catalytically inactive E140A variant to trap substrate interactions

    • Perform crosslinking studies to identify transient interactions

    • Employ bacterial two-hybrid systems using thermostable variants for interaction screening

What techniques are available for monitoring HtpX activity under thermophilic conditions?

Assessing HtpX activity under thermophilic conditions presents unique challenges but can be approached through:

  • High-temperature activity assays:

    • Develop fluorogenic peptide substrates that can withstand high temperatures

    • Monitor cleavage kinetics at elevated temperatures (65-85°C)

    • Use thermostable fluorescent proteins as FRET-based reporters for protease activity

  • Thermal stability assessment:

    • Circular dichroism (CD) spectroscopy to monitor structural changes at different temperatures

    • Differential scanning calorimetry to determine thermal transition points

    • Activity measurements after pre-incubation at various temperatures to establish thermal stability profile

  • Comparative biochemistry:

    • Side-by-side comparison of M. jannaschii HtpX with mesophilic homologs

    • Analysis of activity parameters (kcat, KM) as a function of temperature

    • Identification of structural features contributing to thermostability

How might research on M. jannaschii HtpX inform our understanding of protein evolution in extreme environments?

Research on M. jannaschii HtpX offers unique insights into protein evolution:

  • Thermoadaptation mechanisms:

    • Identification of amino acid substitutions that confer thermostability

    • Analysis of hydrophobic core packing and surface charge distribution compared to mesophilic homologs

    • Understanding how membrane-spanning regions adapt to high-temperature environments

  • Evolutionary conservation:

    • Comparative analysis across archaeal HtpX homologs from different thermal environments

    • Identification of conserved vs. variable regions that might represent adaptation points

    • Analysis of horizontal gene transfer events in the evolution of archaeal proteases

  • Ancient protein quality control systems:

    • M. jannaschii represents a deeply rooted lineage, potentially revealing primitive quality control mechanisms

    • Analysis of HtpX could reveal ancestral functions that preceded divergence of bacteria and archaea

    • Understanding how fundamental quality control mechanisms evolved under extreme conditions

What methodological challenges exist in studying M. jannaschii HtpX and how can they be overcome?

Several key challenges face researchers working with M. jannaschii HtpX:

  • Expression challenges:

    • Codon optimization for expression in E. coli

    • Testing fusion partners that enhance expression and solubility

    • Development of archaeal expression systems for native protein production

  • Activity assessment:

    • Creating assay conditions that mimic the native environment (high temperature, high pressure)

    • Developing thermostable fluorogenic substrates

    • Distinguishing thermal denaturation from actual catalytic activity

  • Structural analysis:

    • Obtaining sufficient quantities of properly folded protein

    • Selecting appropriate detergents that maintain structure while enabling crystallization

    • Balancing between mesophilic and thermophilic conditions in structural studies

  • Genetic manipulation:

    • Limited tools for genetic manipulation of M. jannaschii

    • Developing transformation protocols for archaeal systems

    • Creating reporter systems functional at high temperatures

How can computational approaches complement experimental studies of M. jannaschii HtpX?

Computational methods offer powerful tools for understanding this challenging protein:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.