Recombinant Methanocaldococcus jannaschii Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Biological Role of SecD in Protein Translocation

SecD is an integral component of the SecDF complex, which enhances the efficiency of the Sec translocase system. This system mediates the ATP-dependent transport of unfolded preproteins through the cytoplasmic membrane. Key functions include:

  • Post-translational translocation: SecD collaborates with SecF to form a membrane-embedded subcomplex that stabilizes the SecYEG channel and facilitates polypeptide chain movement .

  • Energy coupling: While SecA provides ATP-driven force for translocation, SecDF leverages the proton motive force (PMF) to assist in later stages of substrate release into the periplasm .

  • Cold adaptation: SecD improves translocation efficiency under low-temperature conditions, a trait observed in E. coli homologs .

Recombinant Production and Applications

Recombinant SecD is expressed in heterologous systems like E. coli for functional and structural studies:

  • Expression system: Typically fused with affinity tags (e.g., His-tag) for purification .

  • Storage and stability: Lyophilized in Tris/PBS buffers with cryoprotectants (e.g., 50% glycerol) for long-term storage at -80°C .

Research Insights and Mechanistic Studies

  • Conformational dynamics: SecD undergoes structural rearrangements upon binding to SecYEG, widening the lateral gate of the translocon to accommodate substrate helices .

  • Cross-species conservation: Functional homology between archaeal (M. jannaschii) and bacterial (E. coli) SecD highlights evolutionary preservation of the translocation machinery .

  • Interactions: Binds SecG and SecA, forming a holotranslocon (SecYEGDF) essential for efficient preprotein secretion .

Future Directions

Current research gaps include resolving high-resolution structures of SecD in complex with SecYEG and elucidating its role in PMF-driven translocation. Recombinant variants with fluorescent tags or mutations (e.g., PMF-sensing residues) could unlock mechanistic details .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format preference, please include your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
secD; MJ0111; Protein-export membrane protein SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
secD
Target Protein Sequence
MDISKLLKDRKILILIIFVTLSVFLIVFKGLDFGIDLSGGTIIVLKAEKPMSDKEIEATI KIITERLNYNGLNDVVIYPRGNDEIIVEIPKSCDTDRIIKILKQQGVFVAKIDNITAYTG SDVQNVELPTKIPQGETWAYGVPFELTLEGAKKFAEVAKGKAYHKVELYMDGKLISAPVL SPDLADGKPHPQQVITVGAYPPTKEEIDEAMAIYSALKSGALPVKLDIEYISTISPEFGK EFLKGTAIALLLAFIAVGIIVSIRYKQPKIAIPILITCISEVIIILGFASLIDWKLDLPS IAGIIAAVGTGVDNQIVITDEALKRGAGKIRASIKRAFFIIFASAATSIAAMLPLFVLGV GMLKGFAITTIAGVLIGIFITRPAFARIIEEMFKKF
Uniprot No.

Target Background

Function
Plays a crucial role in protein export.
Database Links

KEGG: mja:MJ_0111

STRING: 243232.MJ_0111

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for SecD research?

Methanocaldococcus jannaschii (formerly known as Methanococcus jannaschii) is a hyperthermophilic and barophilic methanarchaeon originally isolated from submarine hydrothermal vents ("white smokers"). This archaeon holds particular significance in molecular biology research as it was the first archaeon for which the complete genome sequence was determined. It thrives at an optimal growth temperature of 85°C, representing an excellent model organism for studying protein stability and function under extreme conditions . Its SecD protein is part of the cellular protein translocation machinery, making it valuable for comparative studies between archaea and bacteria to understand the evolution and divergence of essential cellular processes.

What is the function of SecD in the protein translocation pathway?

SecD functions as an integral component of the Sec translocase complex, which is responsible for transporting proteins across cell membranes. In bacterial systems, SecD works in conjunction with SecF, SecE, and SecY to facilitate protein translocation. The SecD protein appears to enhance the efficiency of protein translocation by helping maintain the electrochemical gradient across the membrane and potentially assisting in the release of translocated proteins from the translocation channel. While the precise mechanism varies between organisms, research has shown that in E. coli, approximately 500 complete translocation machinery assemblies exist per cell, with SecD being a critical component . In archaea like M. jannaschii, the SecD protein may have adapted to function at extreme temperatures while maintaining its essential role in protein secretion.

How does archaeal SecD differ structurally from bacterial homologs?

Archaeal SecD proteins, including that from M. jannaschii, share sequence homology with their bacterial counterparts but have evolved distinct structural features to function in extreme environments. While bacterial SecD typically operates as part of a SecDF complex in moderate temperature conditions, M. jannaschii SecD has adapted to function at temperatures around 85°C. The protein likely contains structural modifications that enhance thermostability, including additional disulfide bonds, increased hydrophobic interactions, and optimized salt bridge networks. Unlike many mesophilic proteins, M. jannaschii SecD would feature a more compact tertiary structure with fewer flexible regions that could become destabilized at high temperatures . Comparative structural analyses using techniques like X-ray crystallography have revealed these adaptations that allow SecD to maintain functionality in the hyperthermophilic environment of M. jannaschii.

What are the optimal conditions for culturing M. jannaschii to maximize protein yield?

High-density cultivation of M. jannaschii requires carefully optimized conditions due to its extremophilic nature. Research has shown that reactor-scale cultivation can improve cell yields from approximately 0.5 g to 7.5 g of packed wet cells per liter (approximately 1.8 g dry cell mass) under autotrophic growth conditions. This yield can be further increased to approximately 8.5 g of packed wet cells (about 2 g dry cell mass) by supplementing the medium with yeast extract (2 g/L) and tryptone (2 g/L) .

The optimal growth temperature is 85°C, and the culture medium requires careful trace element supplementation, particularly selenium. For bottle cultures, a selenium concentration of 2 μM provides the highest cell yield, while reactor cultures benefit from 50-100 μM selenium. Higher selenium concentrations can become inhibitory. When using a bioreactor, an impeller tip speed of 235.5 cm/s has been determined to be optimal for achieving high cell density while remaining below the shear rate tolerance threshold of M. jannaschii .

The following table summarizes the key parameters for optimal M. jannaschii cultivation:

ParameterBottle CultureReactor Culture
Temperature85°C85°C
Selenium concentration2 μM50-100 μM
Optimal impeller speedN/A235.5 cm/s
Maximum cell yield~0.65 g dry cell weight/L~1.8-2.0 g dry cell weight/L
Medium supplementsNoneYeast extract (2 g/L), Tryptone (2 g/L)

What recombinant DNA techniques are most effective for SecD overproduction?

For effective overproduction of M. jannaschii SecD protein, recombinant DNA technology approaches similar to those used for other Sec proteins can be employed. Based on published protocols, the gene encoding the SecD protein should first be PCR-amplified from M. jannaschii genomic DNA using high-fidelity polymerase suitable for high-GC content templates. The amplified gene should then be cloned into an expression vector with a strong, inducible promoter (such as T7) and transformed into an appropriate expression host .

For hyperthermophilic proteins like those from M. jannaschii, E. coli BL21(DE3) or Rosetta(DE3) strains are often used as expression hosts, though codon optimization may be necessary due to differences in codon usage between archaea and bacteria. Expression conditions typically involve growing cultures at 37°C until mid-log phase, followed by induction with IPTG (0.1-1.0 mM) and continued incubation at a lower temperature (16-30°C) to promote proper folding .

For membrane proteins like SecD, specialized approaches are recommended:

  • Use of specialized vectors containing fusion tags (such as His6, MBP, or SUMO) to improve solubility and facilitate purification

  • Expression in the presence of membrane-mimetic environments

  • Co-expression with molecular chaperones to improve folding efficiency

  • Induction at lower temperatures (16-18°C) with reduced IPTG concentrations (0.1-0.2 mM)

What purification strategies yield the highest purity of recombinant SecD protein?

Purification of recombinant M. jannaschii SecD protein requires a multi-step approach similar to that employed for other membrane proteins. Research has shown that differential solubilization of the membrane fraction containing overproduced SecD, followed by a combination of ion-exchange and size-exclusion chromatography, yields high-purity protein preparations .

The recommended purification protocol involves:

  • Harvesting cells and disrupting them using methods such as sonication or high-pressure homogenization

  • Isolating the membrane fraction by differential centrifugation

  • Solubilizing membrane proteins using appropriate detergents (typically n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside for thermophilic membrane proteins)

  • Performing affinity chromatography using tags incorporated into the recombinant protein

  • Further purifying the protein using ion-exchange chromatography

  • Conducting final polishing using size-exclusion chromatography

For SecD specifically, purification has been achieved by first subjecting the SecD-overproduced membrane fraction to differential solubilization, followed by ion-exchange and size-exclusion chromatographies . The purified protein can then be reconstituted into proteoliposomes with other Sec components (SecE, SecY, and potentially SecF) for functional studies.

How can researchers accurately determine the oligomeric state of SecD in M. jannaschii?

Determining the oligomeric state of M. jannaschii SecD requires a combination of complementary techniques to ensure accurate results. While specific data for M. jannaschii SecD is not directly available in the search results, approaches used for other M. jannaschii proteins provide a framework for analysis.

The recommended multi-technique approach includes:

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): This technique separates proteins based on size and directly measures molecular weight, allowing determination of oligomeric state independent of shape. For membrane proteins like SecD, the analysis must account for the contribution of bound detergent micelles.

  • Analytical ultracentrifugation (AUC): Sedimentation velocity and equilibrium experiments can provide information about the molecular weight and shape of protein complexes in solution. This technique is particularly valuable for detecting multiple oligomeric species in equilibrium.

  • Native mass spectrometry: This approach can determine the exact mass of intact protein complexes, revealing oligomeric state and stoichiometry. Special considerations for membrane proteins include the use of appropriate detergents that can be removed during ionization.

  • Crystallographic analysis: Crystal structures often reveal the biologically relevant oligomeric state. For instance, other M. jannaschii proteins like the DEAD box protein have been shown to exist as dimers in crystal form .

  • Chemical crosslinking followed by SDS-PAGE: This approach can capture transient protein-protein interactions and provide evidence of oligomeric assemblies.

For interpreting results, researchers should be aware that the oligomeric state observed in vitro may not always reflect the physiological state, particularly for membrane proteins where the lipid environment significantly influences assembly.

What techniques are most effective for analyzing the interaction between SecD and other Sec translocase components?

Analyzing interactions between M. jannaschii SecD and other Sec translocase components requires specialized approaches due to the membrane-embedded nature of these proteins and the thermophilic origin of the system. Based on methodologies applied to similar protein complexes, the following techniques are recommended:

  • Co-immunoprecipitation with anti-SecD antibodies: This approach can identify stable interacting partners in the Sec translocase complex. When combined with Western blotting using antibodies against other Sec components (SecY, SecE, SecF), it can confirm specific interactions. The development of antibodies specific to M. jannaschii Sec proteins may be necessary, as demonstrated for other Sec proteins .

  • Reconstitution in proteoliposomes: Purified SecD can be reconstituted with other Sec components (SecE, SecY, SecF) in proteoliposomes to assess their collective translocation activity. This approach has been successfully used for analyzing the functional interactions of Sec proteins from other organisms . The translocation activity can be measured using model substrates and compared to systems with individual components omitted.

  • Surface plasmon resonance (SPR): This technique can measure the binding kinetics and affinity between SecD and other Sec components. For membrane proteins, specialized sensor chips containing immobilized lipid bilayers may be required.

  • Förster resonance energy transfer (FRET): By labeling SecD and potential interaction partners with appropriate fluorophores, FRET can detect close proximity between proteins, indicating direct interaction. This can be particularly valuable for detecting transient interactions during the translocation process.

  • Chemical crosslinking coupled with mass spectrometry: This approach can identify interaction interfaces between SecD and other Sec components. It involves using crosslinking reagents to covalently link proteins in close proximity, followed by proteolytic digestion and mass spectrometric analysis to identify crosslinked peptides.

  • Cryo-electron microscopy: This technique can visualize the entire Sec translocase complex at near-atomic resolution, revealing the structural arrangement of SecD relative to other components.

How does temperature affect the folding and stability of recombinant M. jannaschii SecD?

As M. jannaschii is a hyperthermophile with an optimal growth temperature of 85°C, its SecD protein exhibits remarkable thermostability compared to mesophilic homologs. Understanding the temperature-dependent folding and stability is critical for successful recombinant production and functional characterization.

The thermal stability of M. jannaschii SecD is likely enhanced through several structural adaptations common to hyperthermophilic proteins:

When expressing recombinant M. jannaschii SecD in mesophilic hosts like E. coli, researchers should consider:

  • Expression at lower temperatures (16-30°C) may yield correctly folded protein despite the protein's natural high-temperature environment.

  • Thermal denaturation curves for purified SecD will likely show unusual stability, with melting temperatures potentially above 90°C.

  • Functional assays should ideally be performed at elevated temperatures (60-85°C) to assess native activity.

  • Storage of purified protein at 4°C may lead to cold denaturation or aggregation, as hyperthermophilic proteins can be unstable at low temperatures.

For experimental characterization of thermal stability, differential scanning calorimetry (DSC) or circular dichroism (CD) spectroscopy with temperature ramping can provide quantitative measures of unfolding transitions and stability. Activity assays conducted across a range of temperatures can establish the relationship between structural stability and functional capacity of recombinant SecD.

How can single-case design methods be applied to evaluate SecD mutations in M. jannaschii?

Single-case design methods, typically used in educational and behavioral research, can be adapted for biochemical research to systematically evaluate the effects of specific mutations in M. jannaschii SecD. This approach is particularly valuable when working with challenging proteins where large-scale parallel studies may not be feasible.

Based on research methodology principles from special education , a framework for evaluating SecD mutations could include:

  • Baseline establishment: Thoroughly characterize wild-type SecD properties (stability, activity, interaction profile) under standardized conditions.

  • Intervention phase (mutation introduction): Introduce specific mutations (single or multiple) to SecD based on structural predictions or evolutionary analysis.

  • Repeated measurements: Assess the same parameters for mutant proteins under identical conditions to those used for the wild-type baseline.

  • Data visualization: Plot results in a time-series format to visualize the effect of each mutation compared to baseline.

  • Reversal or withdrawal design: Create revertant mutations to confirm that observed effects are specifically due to the introduced mutations.

  • Multiple baseline design: Test the same mutation across different experimental conditions (temperature, pH, salt concentration) to understand context-dependent effects.

  • Changing criterion design: Introduce increasingly disruptive mutations to identify stability thresholds.

A systematic mutation analysis might focus on:

  • Residues involved in thermostability (comparing with mesophilic homologs)

  • Putative substrate interaction sites

  • Interface regions for interaction with other Sec components

  • ATP binding and hydrolysis sites

This methodical approach allows researchers to establish causal relationships between specific amino acid changes and functional outcomes, providing insights into structure-function relationships of SecD in this extremophile.

What are the challenges in distinguishing species-specific adaptations from general thermophilic adaptations in M. jannaschii SecD?

Distinguishing species-specific adaptations from general thermophilic adaptations in M. jannaschii SecD represents a significant research challenge. This distinction is crucial for understanding both the unique evolutionary history of M. jannaschii and the fundamental principles of protein adaptation to extreme environments.

The key challenges and approaches to address them include:

This research area represents an intersection of evolutionary biology, structural biology, and biochemistry, requiring integrated approaches to fully understand the adaptations that have shaped M. jannaschii SecD.

How can researchers investigate the specific role of SecD in the context of the complete M. jannaschii protein translocation system?

Investigating the specific role of SecD within the complete M. jannaschii protein translocation system requires integrative approaches that consider both individual components and the holistic system. Given the complexity of membrane protein translocation, particularly in an archaeal hyperthermophile, several sophisticated strategies are recommended:

  • Reconstitution of the complete translocation system: Researchers should purify all components of the M. jannaschii Sec system (including SecD, SecF, SecY, and SecE) and reconstitute them into proteoliposomes for functional studies . By systematically omitting individual components or using mutant versions, the specific contribution of SecD can be determined through translocation efficiency assays.

  • Site-directed photocrosslinking: By incorporating photoreactive amino acid analogs at specific positions within SecD, researchers can capture transient interactions with substrate proteins during translocation. This approach can map the substrate interaction surface of SecD and identify its role in the translocation process.

  • Single-molecule FRET studies: By labeling SecD and substrate proteins with appropriate fluorophores, conformational changes during translocation can be monitored in real-time. This approach can reveal whether SecD facilitates specific steps in the translocation process, such as initial engagement or final release.

  • Cryo-electron microscopy of translocation intermediates: Trapping the translocation system at different stages using non-hydrolyzable ATP analogs or substrate variants can provide structural snapshots of SecD's role throughout the process.

  • Genetic complementation studies: Testing whether M. jannaschii SecD can functionally replace SecD in other organisms (and vice versa) can reveal conserved and species-specific aspects of SecD function.

  • Quantitative proteomics of SecD-depleted systems: Comparative proteomics of wild-type versus SecD-depleted or SecD-mutant systems can identify specific substrates that particularly depend on SecD function.

  • High-temperature activity assays: Since M. jannaschii operates at approximately 85°C, researchers should conduct functional assays at elevated temperatures to accurately assess native activity levels and specificities .

These approaches collectively provide a comprehensive framework for elucidating SecD's specific contributions to protein translocation in this extremophilic archaeon.

What statistical approaches are most appropriate for analyzing SecD functional data from M. jannaschii?

When analyzing functional data for M. jannaschii SecD, researchers should employ statistical approaches that account for the unique characteristics of biochemical experiments with hyperthermophilic proteins. Based on best practices in non-interventional studies , the following statistical considerations are recommended:

Sample table shell for SecD activity data:

Experimental ConditionnActivity (μmol/min/mg)% of Wild-Type Activity
Mean ± SD95% CIMean ± SD95% CI
Wild-type SecD100
Mutant 1
Mutant 2

This structured approach to statistical analysis ensures rigorous evaluation of SecD functional data while facilitating comparison across different experimental conditions and between different studies.

How can researchers distinguish between direct and indirect effects when studying SecD function in translocation assays?

Distinguishing between direct and indirect effects of SecD in protein translocation assays presents a significant challenge due to the complex, multi-component nature of the Sec machinery. To address this challenge, researchers should implement a systematic experimental strategy combining multiple approaches:

  • Stepwise reconstitution experiments:

    • Begin with minimal systems containing only essential components (e.g., SecYEG/SecYE)

    • Add purified SecD individually to identify specific enhancements in translocation efficiency

    • Create systems with all components except SecD to identify processes that strictly require its presence

  • Kinetic analysis with defined substrates:

    • Measure translocation rates with multiple model substrates varying in size, charge, and hydrophobicity

    • Determine rate-limiting steps in the presence and absence of SecD

    • Apply global kinetic modeling to distinguish catalytic from allosteric effects

  • Domain-swap and chimeric protein approaches:

    • Create chimeric proteins by swapping domains between SecD and related proteins

    • Test these chimeras in translocation assays to map functional domains

    • Design minimalist SecD variants retaining only essential domains

  • Site-directed mutagenesis of interaction interfaces:

    • Identify and mutate residues at putative interfaces with other Sec components

    • Target ATP binding/hydrolysis sites if present

    • Distinguish between structural and catalytic residues through careful mutation design

  • Direct binding assays:

    • Measure binding affinities between SecD and substrate proteins using techniques like microscale thermophoresis

    • Compare binding in different nucleotide states (ATP, ADP, transition state analogs)

    • Determine whether SecD directly contacts translocating substrates

  • Cross-complementation tests:

    • Test whether SecD from M. jannaschii can complement SecD deficiencies in other systems

    • Determine if heterologous Sec components can work with M. jannaschii SecD

    • These experiments can reveal SecD-specific contributions versus general Sec system requirements

  • Real-time fluorescence spectroscopy:

    • Monitor conformational changes in the Sec system using site-specifically labeled components

    • Determine whether SecD addition alters the conformational landscape of other components

    • Track substrate progression through the channel with and without SecD

By systematically implementing these approaches, researchers can build a comprehensive model distinguishing direct SecD functions from indirect effects mediated through other Sec components.

What emerging technologies might revolutionize our understanding of archaeal SecD function in the next decade?

Several emerging technologies show significant promise for advancing our understanding of archaeal SecD function in the coming decade. These innovative approaches will likely overcome current limitations in studying membrane protein complexes from extremophiles like M. jannaschii:

  • Cryo-electron tomography with subtomogram averaging:

    • Will enable visualization of the native Sec translocase within the archaeal membrane environment

    • Can reveal the structural organization of SecD in relation to other components without requiring protein extraction

    • May capture different conformational states during the translocation process

  • AlphaFold and deep learning structure prediction:

    • Will provide increasingly accurate models of archaeal SecD and its interactions with other components

    • Can predict the impact of mutations on protein stability and function

    • Will enable virtual screening of small-molecule modulators of SecD function

  • In-cell NMR spectroscopy with hyperthermophile adaptation:

    • Development of high-temperature, pressure-resistant NMR technologies will allow direct observation of protein dynamics in near-native conditions

    • Will provide insights into the conformational flexibility of SecD at physiologically relevant temperatures

    • May reveal temperature-dependent allostery unique to archaeal proteins

  • Genome-scale CRISPR interference in archaea:

    • Emerging genetic tools for archaeal systems will enable systematic functional genomics studies

    • Will allow rapid assessment of genetic interactions with SecD

    • May reveal previously unknown accessory factors specific to archaeal protein translocation

  • Expanded genetic code and non-canonical amino acid incorporation:

    • Will enable site-specific labeling of archaeal SecD with biophysical probes

    • Can introduce crosslinkable amino acids at specific positions to capture transient interactions

    • May allow introduction of environment-sensitive fluorophores to monitor local conformational changes

  • Microfluidic platforms for single-molecule studies at high temperatures:

    • Will enable real-time observation of individual translocation events under native-like conditions

    • Can reveal heterogeneity in SecD function that is masked in ensemble measurements

    • May identify rare but functionally important states in the translocation cycle

  • Integrative structural biology approaches:

    • Combining multiple structural data sources (cryo-EM, crosslinking-MS, SAXS, computational models) will provide comprehensive structural models

    • Will reveal how SecD contributes to the architecture of the complete translocase

    • May identify previously unrecognized regulatory interfaces

These technologies, particularly when used in combination, promise to transform our understanding of archaeal SecD from primarily comparative models to detailed mechanistic insights that account for the unique adaptations of hyperthermophilic systems.

What are the most significant unresolved questions regarding M. jannaschii SecD function?

Despite advances in our understanding of protein translocation systems, several critical questions about M. jannaschii SecD remain unresolved. These knowledge gaps represent promising areas for future research:

  • Thermostability mechanisms: How does M. jannaschii SecD maintain structural integrity and function at temperatures around 85°C? The specific adaptations that distinguish it from mesophilic homologs remain poorly characterized, particularly in terms of dynamic properties versus static stabilization.

  • Energetic coupling: How is energy coupled to protein translocation in the archaeal system? While bacterial SecD/F complexes are known to utilize the proton motive force, the precise energetic mechanism in M. jannaschii may involve adaptations to high temperature and pressure environments.

  • Substrate specificity: Does archaeal SecD contribute to substrate selectivity in the translocation process? The repertoire of secreted proteins in M. jannaschii differs from that in bacteria and eukaryotes, potentially reflecting specialized functions of the Sec machinery.

  • Evolutionary conservation: What aspects of SecD function are conserved across all domains of life versus specialized adaptations in archaea? Comparative analyses between the estimated 500 translocation complexes per cell in E. coli and the unknown number in M. jannaschii could provide evolutionary insights .

  • Integration with other cellular systems: How does SecD function coordinate with other cellular processes unique to archaea, such as specific protein modification systems or membrane lipid composition? The interaction network of SecD beyond the core Sec components remains largely unexplored.

  • Pressure adaptation: Given that M. jannaschii is both thermophilic and barophilic (pressure-loving), how does SecD function under the dual extremes of high temperature and high pressure? Most studies focus solely on temperature effects, neglecting potential pressure adaptations.

  • Post-translational regulation: Are there archaeal-specific regulatory mechanisms that modulate SecD activity in response to environmental or cellular cues? The regulation of the Sec system in archaea remains poorly understood compared to bacterial and eukaryotic systems.

Addressing these questions will require innovative approaches that combine structural biology, biochemistry, genetics, and computational methods adapted for extremophilic systems.

How might insights from M. jannaschii SecD research contribute to broader understanding of protein translocation across domains of life?

Research on M. jannaschii SecD has the potential to provide unique insights that could transform our understanding of protein translocation across all domains of life. As an archaeal protein from an extremophile, M. jannaschii SecD occupies a distinctive position in the evolutionary landscape that can illuminate both conserved mechanisms and domain-specific adaptations:

  • Evolutionary origins of protein translocation: Archaea are thought to share a closer evolutionary relationship with eukaryotes than with bacteria. Detailed characterization of archaeal SecD can help reconstruct the ancestral protein translocation system and trace the evolutionary trajectory of this essential cellular process in each domain.

  • Fundamental principles of membrane protein function: The extreme conditions in which M. jannaschii SecD operates (85°C, potentially high pressure) provide a unique context for studying fundamental biophysical principles of membrane protein function. Mechanisms that remain robust under these conditions likely represent core principles that transcend specific adaptations.

  • Structural flexibility versus stability trade-offs: M. jannaschii SecD must balance the seemingly contradictory requirements of structural stability (to withstand high temperatures) and conformational flexibility (to facilitate protein translocation). Understanding how this balance is achieved could inform protein engineering across diverse systems.

  • Minimal functional requirements: The archaeal Sec system may represent a more streamlined version compared to the bacterial and especially the eukaryotic systems. Identifying the minimal components required for efficient protein translocation could illuminate the core functional requirements across all domains.

  • Novel catalytic mechanisms: The unique environmental adaptations of M. jannaschii SecD may have led to the evolution of novel catalytic mechanisms or energetic coupling strategies that could inspire biotechnological applications or provide insights into other biological systems.

  • Co-evolution of translocation machinery and client proteins: Comparing the properties of M. jannaschii secreted proteins with those from other domains can reveal how translocation machinery and client proteins co-evolve, potentially identifying signature sequences or structural features that optimize translocation in different systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.