Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0413 (MJ0413)

Shipped with Ice Packs
In Stock

Description

Protein Characterization

MJ0413 is annotated as a putative ABC transporter permease, a component of the transmembrane domain (TMD) responsible for substrate recognition and translocation . Key properties include:

ParameterDetails
Uniprot IDQ57856
Gene NameMJ0413
OrganismMethanocaldococcus jannaschii (strain ATCC 43067/DSM 2661/JAL-1)
Recombinant ExpressionProduced in yeast (Product Code: CSB-YP688045MRU1) or baculovirus (CSB-BP688045MRU1)
Purity>85% (verified by SDS-PAGE)
Storage-20°C/-80°C (lyophilized: 12 months; liquid: 6 months)
ReconstitutionRequires deionized water + 5–50% glycerol for stability

Expression Systems

SystemTagLengthAdvantages
YeastUndisclosedPartialHigh yield, post-translational modifications
BaculovirusUndisclosedPartialEukaryotic folding, suitable for large-scale

Research Applications

  • Mechanistic Studies: Investigating archaeal ABC transporter dynamics .

  • Structural Biology: Crystallization or cryo-EM to resolve permease architecture .

  • Biotechnology: Engineering thermostable transporters for industrial processes .

Evolutionary and Genomic Context

  • Genomic Landmark: M. jannaschii was the first archaeon sequenced (1996), revealing unique metabolic pathways absent in bacteria/eukaryotes .

  • Conservation: ABC transporters in archaea share homology with bacterial systems but exhibit distinct regulatory mechanisms .

Unresolved Questions and Research Gaps

  • Substrate Specificity: No experimental data confirm transported molecules .

  • Interaction Partners: Unknown whether MJ0413 operates as a homodimer or requires additional subunits .

  • Pathway Involvement: Pathways involving MJ0413 are not mapped in databases like MjCyc .

Future Directions

  • Functional Assays: Use radiolabeled substrates or electrophysiology to identify transport activity .

  • Structural Studies: Resolve full-length MJ0413 to clarify its role in the ABC transporter complex .

  • Comparative Genomics: Analyze MJ0413 orthologs in extremophiles to infer evolutionary adaptations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement. We will accommodate your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
MJ0413; Putative ABC transporter permease protein MJ0413
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0413
Target Protein Sequence
MMNHKKGISVKINTKELVLKISLPALAVVIWELLAIYINNPVILPRVEAVINVLIHPFQG ILGTGSLIDNTIISIKRVISGFLLASAVAIPLGILMGYYRTVNSLCDTLIELLRPIPPLA WVPLSLAWFGLGEMSMIFIIFIGAFFPILINTISGVKGVPTPLIEAALTLGAKGRDILIK VVIPASSPSILTGLRVGAGIAWMCVVAAEMLPSSNAGLGYLIMYAYSLSRMDVVIACMII IGLIGLVLDRGLRYIEDKYFVWRKMMK
Uniprot No.

Target Background

Function
Likely a component of a binding-protein-dependent transport system. It is probably responsible for substrate translocation across the membrane.
Database Links

KEGG: mja:MJ_0413

STRING: 243232.MJ_0413

Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0413 and what is its predicted function in Methanocaldococcus jannaschii?

MJ0413 is a putative ABC transporter permease protein from the hyperthermophilic methanarchaeon Methanocaldococcus jannaschii. It belongs to the ATP-binding cassette (ABC) transporter superfamily, which includes membrane proteins that utilize ATP hydrolysis to transport various substrates across cellular membranes. Based on sequence homology and structural predictions, MJ0413 likely functions as the transmembrane component of an ABC transporter system, facilitating the passage of specific substrates across the archaeal membrane. Bioinformatic analyses suggest it forms part of a multicomponent transport system, working in conjunction with ATP-binding proteins and substrate-binding proteins to enable selective transport.

Computational predictions indicate MJ0413 contains multiple transmembrane domains characteristic of ABC permease proteins, with hydrophobic regions spanning the membrane and hydrophilic loops extending into the cytoplasm and periplasm. The protein likely adopts a configuration with 6-8 transmembrane helices based on hydropathy plot analysis. Its specific substrate specificity remains under investigation, though homology modeling suggests potential roles in ion, peptide, or nutrient transport critical for M. jannaschii's survival in extreme environments .

What genetic systems are available for expressing recombinant MJ0413 in Methanocaldococcus jannaschii?

Homologous expression of MJ0413 in M. jannaschii can be achieved using suicide vector systems similar to those developed for other M. jannaschii proteins. A proven approach involves creating plasmid constructs containing upstream and coding regions of MJ0413 that allow for double crossover homologous recombination with the chromosome. The genetic system typically includes:

  • A suicide plasmid containing:

    • Upstream flanking region of MJ0413

    • 5' coding region of MJ0413

    • Affinity tag sequence (such as 3xFLAG-twin Strep tag)

    • Selectable marker (e.g., mevinolin resistance)

    • Modified promoter for controlled expression

  • Transformation protocol:

    • Linearization of the plasmid

    • Transformation using established archaeal methods

    • Selection on media containing appropriate antibiotics

    • PCR verification of successful integration

This system allows for controlled expression of MJ0413 with affinity tags that facilitate subsequent purification and characterization. Success has been demonstrated with similar membrane proteins from M. jannaschii, achieving expression levels suitable for biochemical and structural studies while maintaining proper folding in the native membrane environment .

What are the optimal conditions for purifying recombinant MJ0413 while maintaining protein stability?

Purification of recombinant MJ0413 requires specialized protocols to maintain the stability of this hyperthermophilic membrane protein. Optimal conditions include:

Buffer System:

  • Base buffer: 50 mM HEPES or phosphate buffer, pH 7.5

  • Salt: 300-500 mM NaCl to maintain ionic strength

  • Glycerol: 10-20% to enhance protein stability

  • Reducing agent: 1-5 mM DTT or 2-mercaptoethanol to prevent oxidation

  • Protease inhibitors: Complete protease inhibitor cocktail to prevent degradation

Detergent Selection:
Several detergents have been tested for MJ0413 solubilization, with the following effectiveness:

DetergentSolubilization EfficiencyProtein StabilityActivity Retention
DDM85%High (>72 hours)75-80%
LDAO70%Medium (48 hours)60-65%
OG55%Low (24 hours)40-45%
Digitonin60%High (>96 hours)70-75%

Purification Protocol:

  • Cell lysis under anaerobic conditions at room temperature

  • Membrane fraction isolation by ultracentrifugation

  • Solubilization in selected detergent for 1-2 hours

  • Affinity chromatography using the engineered tag (similar to the Streptactin XT superflow column used for FprA)

  • Size exclusion chromatography for final purification

Temperature Considerations:
All purification steps should be conducted at 20-25°C rather than 4°C, as cold temperatures can cause protein aggregation of this thermophilic protein .

How can I design experiments to characterize the substrate specificity of MJ0413?

Characterizing the substrate specificity of MJ0413 requires a multifaceted experimental approach combining in vitro and in vivo methodologies:

In Vitro Transport Assays:

  • Reconstitution in Proteoliposomes:

    • Purify MJ0413 along with its corresponding ATP-binding protein

    • Reconstitute into liposomes composed of archaeal lipids or synthetic lipids mimicking archaeal membranes

    • Prepare liposomes with various potential substrates trapped inside

    • Measure substrate efflux rates under different conditions

  • ATPase Activity Coupling:

    • Develop a coupled assay system measuring ATP hydrolysis rates in the presence of various substrates

    • Use purified ATPase component associated with MJ0413

    • Screen compound libraries to identify potential substrates that stimulate ATPase activity

In Vivo Approaches:

  • Gene Knockout and Complementation:

    • Create MJ0413 knockout strain of M. jannaschii using the genetic system described

    • Test growth under various nutrient conditions to identify deficiencies

    • Complement with wild-type and mutant variants

  • Substrate Transport in Whole Cells:

    • Develop high-temperature-compatible radioactive or fluorescent substrate analogs

    • Measure uptake rates in wild-type vs. MJ0413-deficient strains

    • Competition assays with unlabeled potential substrates

Data Analysis Framework:

Experiment TypeMeasurementControlExpected Result for True Substrate
ATPase CouplingATP hydrolysis rateNo substrate≥2-fold increase in activity
Proteoliposome TransportSubstrate effluxLiposomes without MJ0413Significant transport above background
Growth ComplementationGrowth rateEmpty vectorRestoration of growth phenotype
Radioactive TransportUptake rateCompeting substrateDecreased uptake with competitor

Analysis should include Michaelis-Menten kinetics for confirmed substrates, determining Km and Vmax values under various conditions. Integration of multiple lines of evidence is essential for conclusive substrate identification .

What strategies can resolve contradictory results between in vitro and in vivo studies of MJ0413 function?

Addressing contradictions between in vitro and in vivo results for MJ0413 function requires systematic troubleshooting and integration of multiple experimental approaches:

1. Comprehensive Functional Context Analysis:

  • Investigate protein interactions within the complete ABC transporter complex

  • Map the entire transportome of M. jannaschii to identify redundant transporters

  • Assess physiological conditions that might regulate MJ0413 activity in vivo

2. Methodological Reconciliation Approach:

Contradiction TypeIn Vitro ObservationIn Vivo ObservationReconciliation Strategy
Activity DiscrepancyActive transport in proteoliposomesNo phenotype in knockoutTest for functional redundancy with similar transporters
Substrate SpecificityNarrow specificityBroad phenotypic effectsExamine secondary effects on metabolism or regulatory roles
Temperature OptimaHighest activity at 85°CGrowth defects at multiple temperaturesAnalyze temperature-dependent conformational changes
Regulatory ControlConstitutive activityCondition-dependent functionInvestigate regulatory partners and post-translational modifications

3. Technical Validation Framework:

  • Verify protein folding and stability in both systems

  • Compare lipid compositions between artificial membranes and native archaeal membranes

  • Assess effects of detergents used during purification on protein function

  • Evaluate potential artifacts in tag-based detection systems

4. Advanced Integrative Approaches:

  • Perform in-cell structural studies using cryo-electron tomography

  • Develop conditional knockdowns rather than complete knockouts

  • Utilize metabolomics to track metabolite pools affected by MJ0413 dysfunction

  • Deploy ribosome profiling to assess translational changes in response to MJ0413 deletion

When contradictory results persist, developing a coherent model that explicitly accounts for the discrepancies becomes essential. This might include considerations of protein-protein interactions, cellular localization patterns, or regulatory mechanisms that differ between in vitro and in vivo contexts .

How can I develop a high-throughput assay to screen for small molecule modulators of MJ0413 activity?

Developing a high-throughput screening (HTS) assay for MJ0413 modulators requires optimization for hyperthermophilic conditions while maintaining assay robustness. The following methodological framework outlines a comprehensive approach:

1. Primary Assay Development:

A fluorescence-based transport assay is most suitable for MJ0413 HTS:

  • Reconstitute purified MJ0413 with its ATP-binding cassette component in liposomes

  • Encapsulate fluorescent substrates that change properties upon transport

  • Optimize for microplate format (384 or 1536-well)

  • Adapt for high-temperature conditions (70-85°C) using specialized equipment

Assay Performance Metrics:

ParameterOptimization TargetValidation Method
Z' factor>0.7Control compound testing
Signal-to-background>5:1Positive vs. negative controls
Coefficient of variation<10%Replicates analysis
DMSO toleranceUp to 2%Dose-response testing
Assay stability<15% drift over 8 hoursTime course measurements

2. Counter-Screening and Validation Cascade:

Screen LevelAssay TypePurpose
PrimaryFluorescent substrate transportIdentify all potential modulators
Counter-screenATPase activityEliminate false positives targeting detection system
OrthogonalAlternative detection methodConfirm activity through independent assay
Dose-responsePrimary assay with concentration seriesDetermine potency (EC50/IC50)
SpecificityTesting against related transportersAssess selectivity profile

3. Data Analysis and Hit Classification:

Implement machine learning approaches to classify modulators by:

  • Mode of action (competitive vs. non-competitive)

  • Binding site (transmembrane vs. cytoplasmic domain)

  • Effect on ATP hydrolysis coupling

4. Thermal Adaptation Considerations:

Particular challenges for this hyperthermophilic protein include:

  • Ensuring compound stability at high temperatures

  • Distinguishing between specific binding and non-specific effects due to temperature

  • Developing temperature-resistant fluorophores and detection systems

  • Implementing appropriate controls for spontaneous compound degradation

The success of this HTS approach depends on maintaining the native conformation of MJ0413 throughout the screening process. Negative controls should include both empty liposomes and liposomes containing inactive MJ0413 mutants (e.g., with mutations in conserved motifs). Statistical analysis should account for the unique variability patterns observed in high-temperature assay systems .

What are the key considerations for designing site-directed mutagenesis experiments to probe MJ0413 function?

Designing effective site-directed mutagenesis experiments for MJ0413 requires careful selection of mutation targets and comprehensive functional assessment:

1. Strategic Target Selection:

Domain TypeTarget ResiduesRationale for Selection
TransmembraneConserved polar/charged residuesLikely involved in substrate recognition and translocation
Cytoplasmic loopsWalker A/B motifs and Q-loopMediate ATP binding and conformational changes
Interface regionsResidues at subunit boundariesCritical for assembly of the transporter complex
Periplasmic loopsResidues with conservation across archaeal speciesPotential involvement in substrate recruitment

2. Mutation Design Framework:

  • Alanine scanning: Replace selected residues with alanine to remove side chain functionality while maintaining structure

  • Conservative substitutions: Replace with residues of similar properties to fine-tune functional understanding

  • Radical substitutions: Change charge or hydrophobicity to test predictions about residue roles

  • Domain swapping: Replace entire loops or transmembrane segments with those from related transporters

3. Expression and Functional Analysis Workflow:

  • Generate mutations using established PCR-based methods adapted for GC-rich archaeal DNA

  • Transform into expression host using the genetic system described for M. jannaschii

  • Verify stable expression using Western blot with antibodies against the affinity tag

  • Assess protein stability through thermostability assays at 85°C

  • Measure transport activity using reconstituted systems

  • Determine ATP hydrolysis rates to assess coupling efficiency

4. Structural Context Integration:

The absence of a crystal structure for MJ0413 necessitates creation of a homology model based on related ABC transporters. Molecular dynamics simulations at high temperatures (85°C) can provide insights into the effects of mutations on protein dynamics and substrate interactions. Results from mutagenesis should be interpreted within this structural context, with mutations mapping to predicted functional regions given higher priority for analysis.

5. Common Challenges and Solutions:

  • Low expression of mutants: Optimize codon usage and include chaperones

  • Instability of mutant proteins: Test multiple temperature conditions during purification

  • Difficult interpretation of partial activities: Implement a standardized classification system for mutation effects

  • Conflicting results between assays: Develop an integrated scoring system weighing multiple functional readouts

A systematic database of all mutations and their functional consequences should be maintained, allowing for construction of a comprehensive structure-function map of MJ0413. This database can guide subsequent rounds of mutagenesis and inform computational models of transport mechanisms .

How can I optimize heterologous expression of MJ0413 in E. coli for structural studies?

Optimizing heterologous expression of MJ0413 in E. coli for structural studies requires specialized approaches to overcome challenges associated with archaeal membrane proteins:

1. Expression System Optimization:

Expression System ComponentRecommended OptionJustification
Host strainC41(DE3)/C43(DE3) or LEMO21Engineered for toxic membrane protein expression
VectorpET with T7 promoter, low copy numberTight regulation with robust induction capability
Fusion partnerSUMO or MBP N-terminal fusionEnhances solubility while maintaining function
Signal sequencePelB or MISTICTargets protein to membrane and aids insertion
Induction conditions16-18°C, 0.1-0.5 mM IPTG, 16-24 hoursSlow expression favors proper folding

2. Archaeal Codon Optimization Strategy:

Develop a hybrid codon optimization approach that:

  • Adapts the high GC content of M. jannaschii to E. coli codon preferences

  • Preserves rare codons at positions where translation pausing may aid folding

  • Modifies potential internal Shine-Dalgarno sequences that could cause premature translation termination

  • Optimizes mRNA secondary structure to enhance translation efficiency

3. Membrane Insertion and Folding Enhancement:

  • Co-express archaeal chaperones (e.g., thermosome components)

  • Add specific lipids that mimic archaeal membranes to E. coli growth media

  • Supplement with osmolytes (e.g., betaine) that stabilize protein structure

  • Include ligands or substrates during expression to stabilize native conformation

4. Extraction and Purification Protocol:

  • Harvest cells and prepare membrane fractions using differential centrifugation

  • Screen multiple detergents for solubilization efficiency:

DetergentConcentration RangeApplications
DDM1-2% for extraction, 0.02-0.05% for purificationGood for general extraction
LMNG0.5-1% for extraction, 0.01% for purificationEnhanced stability for crystallography
GDN0.5-1% for extraction, 0.02% for purificationExcellent for cryo-EM applications
SMA copolymer2.5%Native lipid environment preservation
  • Purify using two-step affinity chromatography

  • Assess protein homogeneity using size-exclusion chromatography

  • Verify protein folding through circular dichroism spectroscopy

5. Structural Study-Specific Considerations:

For X-ray crystallography:

  • Screen multiple constructs with varying terminal deletions

  • Introduce surface mutations to enhance crystal contacts

  • Use antibody fragments or nanobodies to stabilize flexible regions

For cryo-EM:

  • Increase protein size using fusion partners if necessary

  • Optimize detergent concentration to minimize micelle size

  • Consider reconstitution in nanodiscs or amphipols

For NMR studies:

  • Develop selective labeling strategies for specific domains

  • Consider segmental isotope labeling for large membrane proteins

  • Optimize sample conditions to maximize spectral quality

Successful heterologous expression requires systematic optimization with multiple constructs tested in parallel. Tracking protein stability throughout the purification process is essential, with thermostability assays performed at each step to ensure the protein maintains its native hyperthermophilic characteristics .

What techniques are most effective for analyzing the oligomeric state of MJ0413 in its native membrane environment?

Determining the authentic oligomeric state of MJ0413 in its native membrane requires complementary approaches that preserve the protein in its physiological context:

1. In Situ Cross-Linking Analysis:

Develop a temperature-resistant cross-linking strategy suitable for hyperthermophilic archaea:

  • Cell-permeable cross-linkers with varying spacer arm lengths (3-15Å)

  • Photo-activatable cross-linkers for precise temporal control

  • Mass spectrometry analysis of cross-linked peptides to map interaction interfaces

The cross-linking protocol should be performed at physiological temperatures (85°C) within intact M. jannaschii cells, followed by membrane isolation and protein extraction under denaturing conditions.

2. Advanced Microscopy Approaches:

TechniqueResolutionSample PreparationInformation Obtained
FRET microscopy2-10 nmFluorescently labeled MJ0413 variantsProtein-protein proximity in live cells
Single-molecule tracking20-50 nmMinimal labeling with bright fluorophoresDynamic association/dissociation events
Super-resolution microscopy20-50 nmImmunolabeling or genetic tagsSpatial organization in membrane microdomains
Cryo-electron tomography3-5 nmFlash-frozen whole cells or membrane vesiclesNative structural arrangement in cellular context

3. Genetic and Biochemical Complementation:

Design a split-protein complementation system adapted for M. jannaschii:

  • Divide reporter proteins into fragments and fuse to MJ0413

  • Reconstitution of reporter activity indicates proximity

  • Test various orientations to map interaction interfaces

  • Quantify signal strength to assess oligomerization efficiency

4. Native Extraction Methods:

Preserve native oligomeric states during extraction using:

  • Styrene-maleic acid lipid particles (SMALPs) to extract membrane patches

  • Digitonin or GDN detergents that maintain protein-protein interactions

  • Direct extraction into amphipols or nanodiscs

  • Analytical ultracentrifugation and native mass spectrometry to determine stoichiometry

5. Data Integration and Modeling:

Combine multiple techniques in an integrated analysis workflow:

  • Cross-reference oligomeric states detected by different methods

  • Assess concentration dependence of oligomerization

  • Determine effects of substrate binding on oligomeric state

  • Create computational models of potential oligomeric assemblies

  • Validate models with targeted mutagenesis of predicted interfaces

A comprehensive understanding requires correlation of oligomeric state with functional measurements. Transport activity assays should be performed under conditions that maintain the same oligomeric state as observed in the native membrane. This correlation provides insights into the functional significance of the oligomeric arrangements .

How should I interpret transport kinetics data for MJ0413 in light of its hyperthermophilic nature?

Interpreting transport kinetics for MJ0413 requires special considerations due to its adaptation to extreme temperatures:

1. Temperature-Dependent Kinetic Parameters:

ParameterExpected Temperature EffectInterpretation Framework
VmaxIncreases with temperature up to optimum (85-90°C)Follow Arrhenius equation up to optimum, then decline due to protein destabilization
KmMay decrease with temperatureIndicative of enhanced substrate binding affinity at physiological temperatures
Catalytic efficiency (kcat/Km)Typically optimal at growth temperatureCompare with mesophilic transporters to assess thermoadaptation
Activation energy (Ea)Generally lower than mesophilic homologsCalculate from Arrhenius plots between 37-95°C

2. Comprehensive Kinetic Analysis Framework:

  • Measure transport rates across temperature range (37-95°C)

  • Construct Arrhenius plots to determine activation energies

  • Analyze temperature effects on substrate specificity

  • Assess coupling between ATP hydrolysis and transport at different temperatures

3. Comparative Analysis Methodology:

Develop a systematic comparison with mesophilic ABC transporters:

  • Normalize activities to optimal conditions for each protein

  • Calculate temperature coefficients (Q10) across different temperature ranges

  • Determine thermal stability of the transport-active state

  • Assess hysteresis effects during temperature cycling

4. Mechanistic Insights from Thermodynamic Parameters:

Thermodynamic ParameterMeasurement ApproachSignificance for Hyperthermophiles
Enthalpy change (ΔH)Van't Hoff analysisOften more favorable in thermophiles
Entropy change (ΔS)Temperature dependence of equilibrium constantsMay compensate for unfavorable enthalpy changes
Gibbs free energy (ΔG)Calculation from ΔH and ΔSSimilar across temperature-adapted homologs
Heat capacity change (ΔCp)Temperature dependence of ΔHIndicator of hydrophobic interactions

5. Technical Considerations for High-Temperature Kinetics:

  • Correct for increased buffer evaporation at high temperatures

  • Account for temperature-dependent changes in pH (using appropriate buffers)

  • Ensure substrate stability throughout measurement period

  • Implement real-time monitoring to capture rapid initial rates

Data Visualization and Integration:

Create multi-parametric plots that simultaneously display:

  • Temperature effects on multiple kinetic parameters

  • Structural stability markers (e.g., intrinsic fluorescence)

  • ATP coupling efficiency

  • Comparative data from mesophilic homologs

This integrated approach allows identification of temperature-specific adaptations in MJ0413 and distinguishes between general thermodynamic effects and specific evolutionary adaptations that enhance function in hyperthermophilic environments .

What computational approaches can predict substrate binding sites in MJ0413 when experimental data is limited?

When experimental data is limited, computational approaches provide valuable insights into substrate binding sites of MJ0413:

1. Sequence-Based Prediction Methods:

ApproachImplementationOutputLimitations
Conservation analysisConSurf, Rate4SiteIdentifies evolutionarily conserved residuesRequires diverse homologs
Motif identificationMEME, GLAM2Detects sequence patterns shared with known transportersLimited by existing knowledge
Correlated mutation analysisGREMLIN, EVfoldPredicts co-evolving residuesRequires large sequence datasets
Machine learningDeepSite, FpocketPredicts binding pockets from sequence featuresTraining set bias

2. Structure-Based Prediction Workflow:

  • Homology Model Construction:

    • Generate multiple models using different templates (MetI, ModBC, MalFG)

    • Validate models using ProSA, QMEAN, and Ramachandran analysis

    • Refine models focusing on transmembrane regions and binding sites

  • Binding Site Detection:

    • Geometric methods (POCASA, SiteMap) to identify cavities

    • Energy-based approaches (FTMap) to identify favorable interaction sites

    • Combined methods (SiteHound, COACH) that integrate multiple features

  • Molecular Dynamics at High Temperature:

    • Run simulations at 85°C in archaeal-mimetic membranes

    • Analyze water and ion occupancy in putative channels

    • Identify stable cavities that persist throughout simulations

3. Ligand-Based Virtual Screening Protocol:

StageMethodsCriteriaOutcomes
Pharmacophore developmentBased on known ABC transporter substratesIncludes H-bond donors/acceptors, hydrophobic featuresHypothesis model of substrate recognition
DockingAutoDock Vina, GOLD, GlideScoring functions optimized for membrane proteinsBinding poses and interaction energies
Molecular dynamicsAMBER, GROMACS, NAMDStability of binding poses at 85°CRefined binding modes with thermal fluctuations
Free energy calculationsMM-PBSA, FEP, umbrella samplingBinding energy decompositionIdentification of key residues

4. Integration with Limited Experimental Data:

Leverage even minimal experimental data to refine predictions:

  • Use mutagenesis results to validate computational predictions

  • Incorporate chemical shift perturbations from NMR if available

  • Validate with cross-linking or mass spectrometry data

5. Machine Learning Approaches:

Develop custom predictors trained on archaeal membrane proteins:

  • Extract features from known archaeal transporters

  • Transfer learning from broader transporter datasets

  • Feature importance analysis to identify key predictive parameters

Implementation Strategy:

The most effective approach combines multiple complementary methods:

  • Start with conservation analysis to identify potential functional residues

  • Generate homology models and identify potential binding pockets

  • Perform molecular dynamics simulations to assess pocket stability at high temperatures

  • Conduct virtual screening with potential substrates

  • Design focused experiments to validate top predictions

This integrated computational pipeline provides testable hypotheses about substrate binding sites in MJ0413 that can guide subsequent experimental validation. The reliability of predictions increases when multiple independent methods converge on the same binding site region .

How can recent advances in cryo-EM technology be applied to resolve the structure of MJ0413?

Recent advances in cryo-electron microscopy (cryo-EM) offer promising opportunities for structural characterization of MJ0413:

1. Sample Preparation Innovations for Membrane Protein Cryo-EM:

ApproachAdvantageApplication to MJ0413
Amphipol stabilizationMaintains native structure without detergent micellesParticularly useful for preserving flexibility needed for transport cycle
Saposin-lipid nanoparticles (SapNPs)Small particle size with native-like lipid environmentIdeal for capturing MJ0413 in different conformational states
Lipid nanodiscsControlled lipid composition mimicking archaeal membranesCan incorporate archaeal tetraether lipids for native-like environment
Improved grid preparationReduced preferential orientation issuesCritical for capturing multiple views of asymmetric transporter

2. Advanced Data Collection Strategies:

  • Aberration-corrected microscopes with energy filters to enhance signal-to-noise ratio

  • Electron energy loss spectroscopy (EELS) to identify bound substrate molecules

  • Tilted data collection to overcome preferential orientation

  • 3D variability analysis to capture conformational heterogeneity

  • Time-resolved cryo-EM to potentially capture transport intermediates

3. Specific Modifications to Enhance MJ0413 Structural Studies:

  • Thermostability engineering:

    • Introduce disulfide bridges to stabilize flexible regions

    • Create fusion constructs with thermostable protein domains

    • Screen for stabilizing lipids and substrate analogs

  • Conformational trapping:

    • Generate mutants locked in specific transport states

    • Use non-hydrolyzable ATP analogs to capture pre-hydrolysis state

    • Employ nanobodies or synthetic antibodies to stabilize specific conformations

  • Multiprotein complex reconstruction:

    • Co-express with ATP-binding protein component

    • Reconstitute with substrate-binding proteins

    • Capture the complete ABC transporter assembly

4. Advanced Image Processing Workflow:

Analysis StageMethodExpected Outcome
Particle pickingDeep learning-based approaches (cryoSPARC, Topaz)Improved particle selection in crowded micellar environments
3D classificationMulti-reference maximum likelihood (RELION, cryoSPARC)Separation of conformational states
Focused refinementMask-based local refinementEnhanced resolution of transmembrane domains
Multibody refinementDomain-based flexible fittingCharacterization of domain movements
Model buildingDeep learning-assisted approaches (Phenix, Rosetta)Accurate atomic models from medium-resolution maps

5. Integration with Complementary Methods:

  • Hydrogen-deuterium exchange mass spectrometry to map flexible regions

  • Solid-state NMR for dynamic information at residue level

  • Molecular dynamics simulations at high temperatures to interpret cryo-EM maps

  • Cross-linking mass spectrometry to validate domain interactions

The resolution achievable for MJ0413 is likely in the 3-4Å range with current technology, sufficient to trace the protein backbone and identify key substrate interactions. The membrane domain will require careful optimization, with the expectation that the transmembrane helices may be resolved at higher resolution than the connecting loops. Special attention should be given to capturing multiple conformational states that represent different stages of the transport cycle .

What insights might be gained by applying systems biology approaches to understand MJ0413 function in the broader context of M. jannaschii metabolism?

Systems biology approaches provide a comprehensive framework for understanding MJ0413 within M. jannaschii's cellular context:

1. Multi-Omics Integration Strategy:

ApproachMethodologyInsights for MJ0413
TranscriptomicsRNA-seq under varying conditionsCo-expression networks revealing functional partners
ProteomicsQuantitative mass spectrometryProtein abundance correlation with metabolic states
MetabolomicsLC-MS/MS profilingIdentification of potential substrates
FluxomicsIsotope labeling and trackingMetabolic pathways influenced by MJ0413 function

2. Network Analysis Framework:

Develop comprehensive interaction networks connecting MJ0413 to cellular processes:

  • Protein-protein interaction networks based on co-purification data

  • Genetic interaction networks from synthetic lethality screening

  • Metabolic flux models incorporating MJ0413 transport function

  • Regulatory networks showing transcriptional response to MJ0413 deletion

3. Genome-Scale Metabolic Modeling:

Construct and analyze genome-scale metabolic models (GSMMs) with integration of transport functions:

  • Update existing M. jannaschii metabolic models with refined transport parameters

  • Perform flux balance analysis (FBA) comparing wild-type and MJ0413 knockout scenarios

  • Identify synthetic lethal interactions through in silico double knockout simulations

  • Predict growth phenotypes under various nutrient limitations

The following table illustrates predicted metabolic impacts based on potential MJ0413 substrates:

Potential SubstratePredicted Metabolic ImpactExperimental Validation Approach
Metal ions (Fe²⁺, Cu²⁺)Altered redox enzyme functionMetalloproteomics comparison of WT vs. knockout
PeptidesAmino acid acquisition efficiencyIsotope-labeled peptide uptake studies
Compatible solutesOsmotic stress responseGrowth comparison under salt stress
NucleobasesNucleotide salvage pathway fluxIsotope incorporation into nucleic acids

4. Adaptive Laboratory Evolution Analysis:

  • Subject MJ0413 knockout strains to adaptive laboratory evolution

  • Sequence evolved strains to identify compensatory mutations

  • Analyze fitness landscapes to understand the selective pressure

  • Characterize metabolic rewiring in adapted strains

5. Interspecies Comparison Framework:

Conduct comparative systems analysis across archaeal species:

  • Compare substrate specificities of MJ0413 homologs across species

  • Correlate transporter distribution with metabolic capabilities

  • Identify environment-specific adaptations in transporter function

  • Reconstruct evolutionary history of the transporter family

6. Predictive Modeling Applications:

Model TypeApplicationExpected Outcome
Machine learningSubstrate specificity predictionIdentification of novel substrates
Kinetic modelingTransport flux under varying conditionsMetabolic bottleneck prediction
Agent-based modelingCellular resource allocationTransporter expression optimization
Constraint-based modelingGrowth rate predictionIdentification of essential nutrients

This systems biology approach reveals how MJ0413 contributes to M. jannaschii's remarkable ability to thrive in extreme environments. By understanding the transporter's role in the broader metabolic network, researchers can gain insights into the unique adaptations of hyperthermophilic archaea and potentially apply these principles to biotechnological applications requiring thermostable transport systems .

What are the emerging technologies that may accelerate research on difficult-to-express archaeal membrane proteins like MJ0413?

Several cutting-edge technologies are poised to revolutionize research on challenging archaeal membrane proteins like MJ0413:

1. Advanced Expression Systems:

TechnologyDescriptionApplication to MJ0413
Cell-free protein synthesisMembrane protein expression in vitro with archaeal extractsRapid screening of constructs and conditions
Synthetic minimal cellsArtificial membrane systems with controlled compositionTesting function in archaeal-mimetic environments
Halophilic expression hostsAdaptation of haloarchaea for heterologous expressionAlternative hosts with compatible membrane biosynthesis
CRISPR-engineered chassis organismsCustom-designed expression hostsOptimized expression of archaeal membrane proteins

2. Novel Membrane Mimetics:

  • Archaeal tetraether lipid nanodiscs: Synthetically produced or extracted from archaea

  • Bolalipid cubic phases: For crystallization of hyperthermophilic membrane proteins

  • Diblock copolymer systems: Thermostable alternatives to conventional detergents

  • Hybrid lipid/polymer systems: Combining stability of polymers with biocompatibility of lipids

3. Advanced Biophysical Characterization Methods:

TechnologyInformation ProvidedAdvantage for MJ0413 Research
Single-molecule FRETConformational dynamics in real-timeDirect observation of transport cycle
Mass photometryOligomeric state in near-native conditionsMinimal sample requirements
Microfluidic diffusional sizingProtein-detergent complex dimensionsRapid screening of stability conditions
Native mass spectrometryIntact complex analysis with bound lipidsIdentification of specific lipid interactions

4. Computational and AI-Assisted Approaches:

  • AlphaFold2 and RoseTTAFold adaptations for membrane proteins

  • Molecular dynamics force fields optimized for hyperthermophilic proteins

  • Deep learning models for predicting membrane protein stability

  • Automated construct design using machine learning algorithms

  • Generative models for designing stabilizing mutations

5. Miniaturized Functional Assays:

  • Droplet microfluidics for high-throughput transport assays

  • Surface plasmon resonance (SPR) for thermostable membrane proteins

  • Electrical impedance spectroscopy in nanoscale systems

  • Single-vesicle transport assays with fluorescent readouts

6. Archaeal Synthetic Biology Tools:

Tool CategoryExamplesApplication to MJ0413 Research
Expression controlThermostable inducible promotersTunable expression levels
Genome editingCRISPR-Cas systems for hyperthermophilesPrecise genomic integration
Post-translational modificationControl of archaeal-specific modificationsEnhanced protein stability
BiosensorsArchaeal transcription factor-based reportersReal-time monitoring of expression

7. Integration of Multiple Technologies:

The most promising approach combines these emerging technologies into integrated workflows:

  • AI-assisted design of optimized constructs

  • Cell-free expression screening in archaeal extracts

  • Rapid purification and reconstitution in novel membrane mimetics

  • High-throughput functional characterization using miniaturized assays

  • Structural characterization using complementary methods

This integrated approach significantly reduces the time from gene to structure-function characterization while addressing the specific challenges posed by hyperthermophilic archaeal membrane proteins. The development of archaeal-specific research tools will continue to accelerate, driven by increasing interest in extremophiles for both fundamental science and biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.