Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0877 (MJ0877)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Putative ABC Transporter Permease Protein MJ0877

The Recombinant Methanocaldococcus jannaschii Putative ABC Transporter Permease Protein MJ0877 is a recombinant protein derived from the archaeon Methanocaldococcus jannaschii. This protein is part of the ABC transporter family, which plays a crucial role in transporting various substrates across cellular membranes using ATP hydrolysis for energy . The MJ0877 protein is specifically identified as a putative ABC transporter permease, suggesting its involvement in the transport of molecules across cell membranes.

2.2. Amino Acid Sequence

The amino acid sequence of the MJ0877 protein is as follows: MDANLLGEKYAISVGVDIKSLRMWLIILSCVLTATVVAFTGPIAFVGITCPILARMICGT SKHIYVIPVTMLLGAVFLVVADILTRPGVLISSTNVLPLLCPLSIIGAPIAIIIYLKIRK MGI .

Function and Mechanism of ABC Transporters

ABC transporters, including the MJ0877 protein, utilize the energy from ATP binding and hydrolysis to transport substrates across cell membranes. They consist of two main domains: the transmembrane domain (TMD) and the nucleotide-binding domain (NBD). The TMD is responsible for substrate recognition and transport, while the NBD binds ATP and drives the transport process through conformational changes .

4.1. Expression and Purification

The recombinant MJ0877 protein is expressed in E. coli and purified to a high purity level, making it suitable for various biochemical studies .

4.2. Potential Applications

While specific applications of the MJ0877 protein are not widely documented, ABC transporters in general are crucial for understanding cellular transport mechanisms and have implications in fields such as biotechnology and medicine. For instance, ABC transporters are involved in drug resistance mechanisms in bacteria, making them targets for therapeutic interventions .

References General information on Methanocaldococcus jannaschii. Creative BioMart. Recombinant Full Length Methanocaldococcus jannaschii Putative ABC Transporter Permease Protein MJ0877. Introductory Biology I. Chapter 21: Protein Structure and Function. Wikipedia. ABC Transporter. PubMed. Expression, purification, and biochemical characterization of Methanocaldococcus jannaschii DNA ligase. MyBioSource. Putative ABC Transporter Permease Protein MJ0877. LibreTexts. Structure & Function - Proteins I. InterPro. ABC Transporter, Permease. Creative BioMart. MJ0877.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0877; Putative ABC transporter permease protein MJ0877
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0877
Target Protein Sequence
MDANLLGEKYAISVGVDIKSLRMWLIILSCVLTATVVAFTGPIAFVGITCPILARMICGT SKHIYVIPVTMLLGAVFLVVADILTRPGVLISSTNVLPLLCPLSIIGAPIAIIIYLKIRK MGI
Uniprot No.

Target Background

Function

This protein is likely a component of a binding-protein-dependent transport system. Its function is probably the translocation of substrate across the membrane.

Protein Families
Binding-protein-dependent transport system permease family, FecCD subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does MJ0877 relate to other ABC transporters in archaea?

ABC transporters constitute one of the largest families of membrane proteins across various organisms, including archaea . In M. jannaschii, MJ0877 is part of a broader system of ABC transporters that are essential for survival in extreme environments.

Unlike many bacterial ABC transporters that have been extensively characterized, archaeal ABC transporters - particularly those from hyperthermophiles like M. jannaschii - remain less well understood. Research comparing MJ0877 with other archaeal ABC transporters reveals conserved structural features typical of the ABC transporter superfamily, including:

  • Membrane-spanning domains that form the translocation pathway

  • Nucleotide-binding domains that bind and hydrolyze ATP

  • Substrate-binding proteins that confer specificity

The evolutionary position of M. jannaschii as one of the most deeply rooted organisms in the archaeal domain makes its ABC transporters particularly valuable for understanding the evolution of membrane transport systems . Genome sequencing of M. jannaschii was a milestone event, being the first archaeal genome to be completely sequenced, which helped establish the three-domain classification of life (Bacteria, Archaea, and Eukarya) .

What are the optimal conditions for expressing recombinant MJ0877 protein?

Successful expression of recombinant MJ0877 requires careful optimization of expression systems and conditions. Based on research protocols, the following methodological approach is recommended:

Expression System Selection:

  • E. coli expression systems are most commonly used due to their simplicity and high yield potential for MJ0877

  • Alternative expression hosts include yeast, baculovirus, or mammalian cell systems for specific experimental requirements

Expression Protocol:

  • Clone the MJ0877 gene (coding for amino acids 1-123) into an appropriate expression vector with a His-tag for purification purposes

  • Transform the construct into an E. coli strain optimized for protein expression (BL21, Rosetta, or similar)

  • Culture conditions:

    • Growth medium: LB or 2YT media supplemented with appropriate antibiotics

    • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

    • Post-induction: Continue culture for 4 hours at 37°C or overnight at lower temperatures (16-25°C)

Purification Strategy:

  • Cell lysis using mechanical disruption (sonication or cell disrupter)

  • Membrane fraction isolation through ultracentrifugation (100,000 g for 1 hour)

  • Solubilization of membrane proteins using appropriate detergents

  • Affinity chromatography using Ni-NTA or Streptactin XT columns (depending on tag)

  • Buffer optimization: Tris-based buffer with 50% glycerol at pH 8.0

The final product should have a purity greater than 90% as determined by SDS-PAGE, and lyophilization is recommended for long-term storage .

How can researchers establish a reliable genetic system for manipulating MJ0877 in M. jannaschii?

Establishing a genetic system for M. jannaschii has been challenging due to its extremophilic nature, but recent advances have made it possible. The following methodology has proven successful:

Growth and Culture Conditions:

  • Culture M. jannaschii in specialized medium with H₂ and CO₂ mixture (80:20, v/v) at 80°C

  • For liquid culture: Use sealed serum bottles with anaerobic conditions

  • For solid medium: Prepare plates with Gelrite® as a gelling agent (0.7% final concentration) with additional reducing agents (cysteine or titanium (III) citrate)

Transformation Protocol:

  • Prepare suicide vector construct containing:

    • Homologous regions flanking the target gene (MJ0877)

    • Desired genetic modifications (knockout, tag addition, etc.)

    • Selectable marker (e.g., mevinolin resistance)

  • Linearize the vector to promote double crossover recombination

  • Apply heat shock for transformation rather than chemical treatments like PEG or liposomes

  • Select transformants on solid medium containing appropriate antibiotics (mevinolin at 10-20 μM)

Verification Methods:

  • PCR-based analysis of chromosomal DNA to confirm successful genetic modification

  • Western blot analysis using appropriate antibodies if protein tagging was performed

  • Functional assays to verify phenotypic changes resulting from genetic manipulation

This approach has been successfully demonstrated for other proteins in M. jannaschii, providing a framework for genetic manipulation of MJ0877 .

How does MJ0877 contribute to membrane stability and antibiotic resistance in prokaryotes?

Studies on ABC transporter permeases in various prokaryotes provide insights into potential roles of MJ0877 in membrane stability and antibiotic resistance. While direct evidence for MJ0877 is limited, comparative analysis with homologous proteins reveals:

Membrane Integrity Maintenance:
ABC transporter permeases like MJ0877 are crucial for maintaining membrane homeostasis. Research on related proteins demonstrates that:

  • These proteins often mediate the transport of lipids and other molecules essential for membrane structure

  • Mutation or deletion of ABC transporter permease genes frequently results in altered membrane composition and integrity

  • Changes in membrane properties can affect cellular responses to environmental stressors

Antibiotic Resistance Implications:
Studies on ABC transporter permease homologs reveal potential roles in antibiotic resistance mechanisms:

Antibiotic ClassSensitivity Change in Permease MutantsProposed Mechanism
Tetracyclines (doxycycline, tigecycline)Increased sensitivityAltered membrane permeability affecting drug influx/efflux
Polymyxins (colistin)Increased sensitivityDisrupted membrane stability affecting resistance to membrane-disrupting agents
ChloramphenicolIncreased sensitivityModified facilitated diffusion across membrane
Combined agents (EDTA + membrane-active compounds)Dramatic synergistic sensitivityCompromised membrane barrier function

These findings suggest that MJ0877 may play a similar role in M. jannaschii, potentially affecting its resistance to membrane-active compounds in its extreme environment .

What statistical approaches are most appropriate for analyzing MJ0877 functional data?

Descriptive Statistics:

  • For continuous variables (e.g., transport rates, binding affinities): Use mean and standard deviation for normally distributed data or median and interquartile range for non-normally distributed data

  • For categorical variables (e.g., substrate specificity, localization): Use proportions or percentages

Inferential Statistics Based on Research Question:

Research Question TypeRecommended Statistical TestData Requirements
Comparing MJ0877 activity under different conditionsPaired t-test (paired samples) or independent t-test (unpaired samples)Normally distributed continuous data
Comparing MJ0877 activity under different conditions (non-parametric)Wilcoxon signed-rank test (paired) or Mann-Whitney U test (unpaired)Non-normally distributed continuous data
Comparing multiple experimental conditionsOne-way ANOVA with post-hoc testsNormally distributed data with homogeneous variance
Comparing multiple experimental conditions (non-parametric)Kruskal-Wallis H testNon-normally distributed data
Correlation between variables (e.g., substrate concentration vs. transport rate)Pearson correlation coefficient (linear) or Spearman rank correlation (non-linear)Continuous variables
Predicting outcomes based on multiple variablesMultiple linear regression or logistic regressionDependent on outcome variable type

Special Considerations for MJ0877 Research:

  • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests before selecting parametric tests

  • Consider repeated measures designs when testing the same protein preparation under different conditions

  • Use appropriate post-hoc corrections (e.g., Bonferroni, Tukey HSD) for multiple comparisons

  • Consider mixed-effects models when combining data from multiple experimental batches

What structural characteristics enable MJ0877 to function in extreme thermophilic conditions?

The ability of MJ0877 to function at the extreme temperatures (up to 80°C) encountered by M. jannaschii in deep-sea hydrothermal vents results from specific structural adaptations. Analysis of MJ0877 and other proteins from this hyperthermophilic archaeon reveals:

Primary Sequence Adaptations:

  • Increased proportion of charged amino acids (particularly glutamic acid and lysine) that form salt bridges

  • Higher frequency of hydrophobic residues in the protein core

  • Reduced frequency of thermolabile amino acids (asparagine, glutamine, cysteine, and methionine)

Structural Stabilization Mechanisms:

  • Extensive ionic interactions forming networks of salt bridges

  • Enhanced hydrophobic packing in the protein core

  • Shorter surface loops that are less susceptible to thermal fluctuations

  • Additional disulfide bonds for increased stability

The membrane-spanning regions of MJ0877 (amino acids 18-38, 46-66, and 76-96) contain predominantly hydrophobic residues that anchor the protein within the lipid bilayer, while the charged residues at position 6-10 (KYAIS) and 115-119 (KIRKM) likely participate in ionic interactions with other components of the ABC transporter complex .

How can researchers experimentally determine the substrate specificity of MJ0877?

Determining the substrate specificity of MJ0877 requires a systematic experimental approach combining biochemical, biophysical, and genetic techniques:

In Vitro Transport Assays:

  • Reconstitution of purified MJ0877 into liposomes with its associated ATP-binding protein

  • Preparation of radioactively labeled or fluorescently tagged potential substrates

  • Measurement of substrate uptake into liposomes under varying conditions

  • Competition assays with unlabeled substrates to determine binding specificity

Binding Studies:

  • Isothermal Titration Calorimetry (ITC) to measure binding affinities of potential substrates

  • Surface Plasmon Resonance (SPR) to analyze binding kinetics

  • Fluorescence-based binding assays using intrinsic tryptophan fluorescence or extrinsic fluorescent probes

Genetic Approaches:

  • Generation of MJ0877 knockout strains using the genetic system described in section 2.2

  • Complementation studies with wild-type and mutant versions of MJ0877

  • Growth analyses of knockout and complemented strains on various substrates

  • Suppressor mutation analysis to identify interacting genes/proteins

Structural Biology Techniques:

  • X-ray crystallography or cryo-electron microscopy of MJ0877 with bound substrates

  • Homology modeling combined with molecular dynamics simulations

  • Site-directed mutagenesis of predicted substrate-binding residues

  • EPR spectroscopy combined with site-directed spin labeling to probe conformational changes upon substrate binding

These approaches should be performed under conditions mimicking the native environment of M. jannaschii (high temperature, appropriate pH, and ionic strength) to obtain physiologically relevant results.

What are the best approaches for studying MJ0877 protein-protein interactions within the ABC transporter complex?

Investigating protein-protein interactions involving MJ0877 requires specialized techniques that can capture these interactions under conditions that maintain protein structure and function:

Co-immunoprecipitation with Tagged Variants:

  • Express MJ0877 with affinity tags (as described in sections 2.1 and 2.2)

  • Perform gentle solubilization of membrane complexes using mild detergents

  • Capture MJ0877 complexes using tag-specific antibodies or affinity resins

  • Identify interacting partners through mass spectrometry analysis

In Vivo Crosslinking:

  • Treat living M. jannaschii cells with membrane-permeable crosslinkers

  • Lyse cells and isolate crosslinked complexes

  • Analyze complexes by SDS-PAGE followed by Western blotting or mass spectrometry

  • Reverse crosslinking and confirm interactions through secondary methods

Förster Resonance Energy Transfer (FRET):

  • Generate fusion proteins of MJ0877 and potential partners with appropriate fluorophores

  • Express the fusion proteins in M. jannaschii or a suitable model system

  • Measure energy transfer between fluorophores as an indication of protein proximity

  • Analyze FRET efficiency under different conditions (substrate availability, ATP concentration)

Split-protein Complementation Assays:

  • Split a reporter protein (e.g., luciferase) into two non-functional fragments

  • Fuse these fragments to MJ0877 and potential interaction partners

  • Co-express the fusion proteins in an appropriate host

  • Measure reporter activity as an indication of protein-protein interaction

These approaches can help map the complete interaction network of MJ0877 within the ABC transporter complex and identify regulatory proteins that modulate its activity .

How can researchers integrate computational and experimental approaches to study MJ0877 function?

An integrated computational and experimental approach provides the most comprehensive understanding of MJ0877 function. The following workflow demonstrates how these approaches can complement each other:

Computational Analysis Pipeline:

  • Sequence Analysis:

    • Multiple sequence alignment with homologous proteins

    • Identification of conserved motifs and functional residues

    • Phylogenetic analysis to trace evolutionary relationships

  • Structural Prediction:

    • Homology modeling based on crystal structures of related ABC transporter permeases

    • Molecular dynamics simulations at high temperatures to mimic native conditions

    • Docking studies with potential substrates and interacting proteins

  • Systems Biology Approaches:

    • Network analysis to identify functional associations

    • Gene co-expression analysis using transcriptomic data

    • Metabolic modeling to predict the impact of MJ0877 on cellular metabolism

Integration with Experimental Data:

  • Use computational predictions to guide experimental design:

    • Target specific residues for mutagenesis based on structural models

    • Select potential substrates for transport assays based on docking results

    • Identify potential interacting partners for experimental validation

  • Refine computational models with experimental data:

    • Update structural models based on crosslinking constraints

    • Refine substrate specificity predictions based on transport assay results

    • Adjust network models based on protein-protein interaction data

  • Iterative improvement cycle:

    • Generate new hypotheses based on integrated data

    • Design targeted experiments to test specific aspects of these hypotheses

    • Incorporate new experimental results into refined computational models

This integrated approach has successfully elucidated the function of several ABC transporters and can be effectively applied to understand MJ0877's role in M. jannaschii .

What are common challenges in expressing and purifying functional MJ0877, and how can they be overcome?

Working with membrane proteins like MJ0877 presents several challenges that researchers should anticipate and address:

Challenge 1: Low Expression Levels

  • Problem: Membrane proteins often express poorly in heterologous systems

  • Solutions:

    • Optimize codon usage for the expression host

    • Use lower growth temperatures (16-25°C) during expression

    • Test different expression hosts (C41/C43 E. coli strains designed for membrane proteins)

    • Consider cell-free expression systems specifically optimized for membrane proteins

    • Use autoinduction media instead of IPTG induction

Challenge 2: Protein Misfolding and Aggregation

  • Problem: Hyperthermophilic proteins may misfold at mesophilic temperatures

  • Solutions:

    • Express at elevated temperatures if the host can tolerate it

    • Include molecular chaperones as co-expression partners

    • Use fusion tags that enhance solubility (SUMO, MBP, etc.)

    • Optimize buffer conditions to stabilize the native conformation

    • Add stabilizing agents like glycerol, specific ions, or substrate analogs

Challenge 3: Inefficient Membrane Extraction

  • Problem: Incomplete solubilization from membranes

  • Solutions:

    • Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction

    • Optimize detergent:protein ratio

    • Test different solubilization temperatures and times

    • Consider detergent mixtures or newer amphipathic polymers (SMALPs)

    • Use sequential extraction with increasing detergent concentrations

Challenge 4: Loss of Function During Purification

  • Problem: Functional activity diminishes during purification

  • Solutions:

    • Minimize purification steps to reduce protein loss

    • Include substrate or substrate analogs during purification

    • Maintain essential lipids throughout purification

    • Use mild detergents even if extraction efficiency is lower

    • Reconstitute into nanodiscs or liposomes as soon as possible after purification

How can researchers address data inconsistencies in MJ0877 functional studies?

When faced with inconsistent results in MJ0877 research, systematic troubleshooting and robust experimental design are essential:

Source Analysis and Validation:

  • Verify protein identity and integrity:

    • Confirm protein sequence by mass spectrometry

    • Check for degradation using SDS-PAGE and Western blotting

    • Verify proper folding using circular dichroism or other spectroscopic methods

  • Assess protein activity:

    • Develop reliable activity assays with appropriate controls

    • Determine batch-to-batch variation in specific activity

    • Standardize protein:lipid:detergent ratios for consistent measurements

Experimental Design Considerations:

  • Control environmental variables:

    • Temperature fluctuations (especially critical for thermophilic proteins)

    • pH stability throughout the experiment

    • Buffer composition and ionic strength

    • Presence of contaminating ATPases or phosphatases

  • Standardize data collection:

    • Use standardized protocols with detailed methodology documentation

    • Implement appropriate data collection methods as outlined in section 2.3

    • Ensure consistent time points and measurement parameters

    • Include internal standards and reference controls in each experiment

Statistical Approaches for Handling Inconsistent Data:

  • Identify and handle outliers appropriately:

    • Use statistical tests to identify outliers (Grubbs' test, Dixon's Q test)

    • Consider whether outliers represent true biological variation or technical errors

    • Report all data transparently, including outliers

  • Apply appropriate statistical methods:

    • Use paired designs when comparing conditions to reduce inter-sample variation

    • Consider non-parametric tests when data distribution is uncertain

    • Apply mixed-effects models to account for batch effects and nested variables

    • Calculate and report effect sizes in addition to p-values

  • Implement meta-analytical approaches:

    • Combine data from multiple experiments using formal meta-analysis

    • Weight results based on sample size and variance

    • Test for heterogeneity across experiments to identify sources of inconsistency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.