Recombinant Methanocaldococcus jannaschii Putative antitoxin VapB5 (vapB5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Putative Antitoxin VapB5 (vapB5)

Recombinant VapB5 is a His-tagged protein derived from Methanocaldococcus jannaschii, a thermophilic methanogen isolated from deep-sea hydrothermal vents . The protein is classified as a putative antitoxin in the VapB family, which counteracts toxin proteins (e.g., VapC) in bacterial/archaeal toxin-antitoxin (TA) systems . Its recombinant form is engineered for research applications, with full-length sequence (1–107 amino acids) and high purity (>90% by SDS-PAGE) .

Toxin-Antitoxin System Context

TA systems regulate bacterial/archaeal survival under stress. VapB5 likely antagonizes a VapC toxin, preventing nonspecific RNA degradation . In M. jannaschii, such systems may aid survival in extreme environments (e.g., high temperature, sulfide-rich vents) .

Pathway and Interaction Networks

VapB5 is linked to pathways involving RNA processing and stress response, though specific interactions remain uncharacterized .

PathwayPutative RoleRelated Proteins
RNA StabilityRegulation of mRNA/rRNA turnoverVapC, Smg6, Rrp44
Stress ResponseProtection against oxidative stressCoenzyme F420-dependent enzymes

Recombinant Protein Utilization

  • SDS-PAGE: Used to validate purity and confirm successful expression .

  • ELISA Development: Potential use in antibody-based assays (e.g., detecting VapB5 in M. jannaschii lysates) .

  • Structural Studies: His-tag facilitates affinity chromatography for crystallization .

Genetic and Biochemical Tools

Recent advances in M. jannaschii genetic systems (e.g., gene knockout, tagged protein expression) enable future functional studies on VapB5 .

Challenges and Future Directions

  • Functional Gaps: Direct evidence of VapB5’s antitoxin activity in M. jannaschii remains sparse.

  • Evolutionary Significance: Comparative studies with other VapB proteins could clarify its role in archaeal TA systems .

  • Biotechnological Potential: Engineering VapB5 for applications in RNA protection or stress tolerance in extremophiles.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
vapB5; MJ1473.1; Putative antitoxin VapB5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
vapB5
Target Protein Sequence
MQGPVIIPLISTLGLSFLAILLAYKISFSVIGFINSTLPTTLFPSKPYMLFVKISTISPL TCPSLIILTPALTWSLTALSMAYLYSSYKPNTFFTLSKNVSSFLTTG
Uniprot No.

Target Background

Function
This protein is potentially the antitoxin component of a type II toxin-antitoxin (TA) system. Its corresponding toxin is VapC5 (Potential).
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii VapB5 and why is it significant for research?

Methanocaldococcus jannaschii VapB5 (vapB5) is a putative antitoxin protein that functions as part of a toxin-antitoxin (TA) system in this archaeal organism. M. jannaschii is particularly significant for evolutionary biology research because it:

  • Performs a respiratory metabolism that is approximately 3.5 billion years old

  • Lives in deep-sea hydrothermal vents under conditions similar to early Earth

  • Grows in the absence of light and oxygen at temperatures approaching boiling point

  • Serves as a model organism for understanding ancient metabolic pathways

VapB5 itself is significant as part of the VapBC toxin-antitoxin system that helps regulate growth and metabolism in extreme conditions. This system consists of a stable toxin (VapC) and a labile antitoxin (VapB) that neutralizes the toxin under normal conditions .

What is the molecular structure and composition of recombinant VapB5?

Recombinant M. jannaschii VapB5 has the following characteristics:

ParameterDetails
Protein LengthFull Length (1-107 amino acids)
TagHis (N-terminal)
Source for recombinant expressionE. coli
Amino Acid SequenceMQGPVIIPLISTLGLSFLAILLAYKISFSVIGFINSTLPTTLFPSKPYMLFVKISTISPLTCPSLIILTPALTWSLTALSMAYLYSSYKPNTFFTLSKNVSSFLTTG
FormTypically supplied as lyophilized powder
Purity>90% as determined by SDS-PAGE

VapB antitoxins generally consist of two functional domains:

  • An N-terminal region that binds to the promoter DNA of the TA operon

  • A C-terminal region that binds to the toxin and abolishes its toxicity

How should researchers handle and reconstitute recombinant VapB5 for experimental use?

For optimal handling of recombinant VapB5:

  • Storage conditions: Store at -20°C/-80°C upon receipt

  • Preparation before use: Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitution protocol:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

  • Working storage: Store working aliquots at 4°C for up to one week

  • Stability considerations: Repeated freezing and thawing is not recommended

What basic applications and techniques are used to study VapB5?

Common techniques for studying VapB5 include:

  • SDS-PAGE: For purity assessment and basic characterization

  • Western blotting: For detection using His-tag antibodies

  • Protein-protein interaction assays: To study VapB5-VapC5 interactions

  • Circular dichroism (CD): To analyze secondary structure

  • Functional assays: To evaluate antitoxin activity

Researchers should note that VapB5 is typically studied in the context of its interaction with its cognate toxin VapC5, as the biological relevance lies in understanding the toxin-antitoxin system as a whole .

How does VapB5 interact with its cognate toxin VapC and what methods can detect these interactions?

VapB5 interacts with VapC through its C-terminal region to neutralize the toxin's activity. Based on studies of similar VapBC systems, several methodological approaches can be used to characterize these interactions:

  • Surface Plasmon Resonance (SPR):

    • Immobilize VapC5 on a CM5 sensor chip at approximately 750 response units

    • Use running buffer containing 10 mM HEPES (pH 7.5) and 150 mM NaCl

    • Observe association and dissociation for 300 and 500 seconds, respectively

    • Test multiple concentrations of VapB5 to determine binding kinetics

    • Regenerate the chip surface using multiple pulses of 10 mM NaOH

  • Co-crystallization studies:

    • Use specialized conditions (e.g., containing ammonium sulphate, sodium formate, sodium cacodylate)

    • Employ oil microbatch-under-oil crystallization methods for improved crystal quality

    • Process data using programs like iMOSFLM and SCALA

    • Solve structures using molecular replacement methods with related VapBC structures as search models

  • Binding mechanism insights:
    In related VapBC systems, the antitoxin binding involves:

    • Reorientation of specific residues (e.g., Arg-112 in VapC-5)

    • Conformational changes that prevent binding of essential metal ions

    • Secluding active site residues in catalytically unfavorable conformations

What is the mechanism of transcriptional regulation by the VapBC5 system in M. jannaschii?

The VapBC toxin-antitoxin system regulates its own transcription through a negative feedback loop:

  • Autoregulation mechanism:

    • VapB5 alone or in complex with VapC5 acts as a repressor of the vapBC operon

    • The antitoxin's N-terminal region binds to the promoter DNA of the TA operon

    • The VapBC complex binds cooperatively to DNA regulatory elements

  • Regulatory dynamics:

    • During steady state growth, VapB is maintained in excess of VapC

    • Under nutrient stress or antibiotic treatment, proteases (like Lon) degrade VapB

    • When VapC is in excess of VapB, it interferes with cooperative DNA binding

    • This interference depends on the dimerization of the VapC toxin

  • Transcriptional response:

    • The toxin can play an additional role in stimulating transcription

    • The antitoxin:toxin ratio is critical for cooperative DNA binding

    • This system allows rapid adaptation to environmental stresses

How do researchers determine the ribonuclease target specificity of VapC toxins?

While the specific targets of M. jannaschii VapC have not been fully characterized in the search results, methodologies from related VapC studies can be applied:

  • 5' RNA-seq approach:

    • This specialized RNA-seq method identifies RNAs cleaved by VapC on a genome-scale

    • Maps toxin cleavage sites to single-nucleotide resolution

    • Exploits the fact that VapC toxins generate a 5' monophosphate (-P) upon RNA cleavage

    • This 5'-P moiety distinguishes toxin-generated products from intact cellular RNAs

  • In vitro cleavage assays:

    • Using fluorescent-labeled RNA substrates in different buffers

    • Detecting fluorescence when substrate is cleaved by nuclease activity

    • Testing Mg²⁺-dependence of activity (typically in Tris buffer, pH 7.0 containing 150 mM NaCl)

    • Confirming specificity through controls with EDTA (which should abolish activity)

  • Comparative analysis of VapC targets:
    Studies of related VapC toxins have shown:

    • Some target tRNAfMet in the anticodon stem-loop in vivo and in vitro

    • Others target tRNASerCGA

    • Some target the 23S rRNA in the sarcin-ricin-loop

    • VapC-dependent depletion of specific tRNAs can lead to bacteriostatic inhibition of global translation

What challenges exist in expressing and purifying active M. jannaschii VapBC complexes?

Working with proteins from hyperthermophilic archaea presents unique challenges:

  • Expression system considerations:

    • E. coli is typically used for heterologous expression despite differences in codon usage and folding machinery

    • Temperature optimization is critical (M. jannaschii grows at ~80°C while E. coli grows at 37°C)

    • Expression vectors must be carefully selected (e.g., pet22b+ vector with C-terminal His-tags)

  • Complex stability issues:

    • VapB-VapC complexes are often tight but can dissociate under certain buffer conditions

    • The presence of detergents in purification buffers may disrupt the complex

    • Native PAGE analysis should be performed to confirm complex integrity

    • High salt content is often required during purification

  • Separation challenges:

    • Attempts to separate VapB and VapC in the complex can be difficult

    • The toxin-antitoxin binding is typically tight, resulting in few molecules of free toxin in samples

    • This tight binding is necessary for stringent control of the toxic VapC component

  • Activity verification:

    • Low activity may be detected due to minimal free toxin in samples

    • Functional assays must account for this tight binding phenomenon

    • Mg²⁺-dependence testing is essential for confirming authentic activity

How does the genetic system for M. jannaschii facilitate research on VapB5 and related proteins?

A genetic system for M. jannaschii allows manipulation of the organism's chromosome, enabling researchers to:

  • Create targeted genetic modifications:

    • Insert or delete genes to study their function

    • Introduce mutations to examine specific protein domains

    • Generate strains with altered levels of VapB5 expression

  • Transformation methodology:

    • Grow M. jannaschii at 65°C until reaching OD600 of 0.5-0.7

    • Harvest cells in an anaerobic chamber

    • Resuspend cells in pre-reduced medium containing sodium sulfide

    • Incubate at 4°C for 30 min before adding linearized DNA

    • Apply heat shock at 85°C for 45 seconds

    • Incubate at 80°C overnight without shaking

  • Selection system:

    • Uses mevinolin or simvastatin resistance as selectable markers

    • Resistance can be conferred by overexpressing HMG-CoA reductase (hmgA gene)

    • Strong constitutive promoters can be used for gene expression

  • Advantages over other archaeal systems:

    • M. jannaschii grows faster (doubling time of 26 min vs. 2-8.5 hours for other methanogens)

    • Colonies form in 3-4 days (vs. 7-14 days for other species)

    • Transformation requires heat shock rather than expensive chemicals like PEG or liposomes

How does the structure of M. jannaschii VapB5 compare with antitoxins from other organisms?

Comparative analysis of VapB5 with other antitoxins reveals interesting structural and functional insights:

  • Structural comparisons:

    • M. jannaschii VapB5 is a 107-amino acid protein with a predicted N-terminal DNA-binding domain and C-terminal toxin-binding domain

    • When comparing with mycobacterial VapB antitoxins, significant structural differences exist despite functional similarities

    • In some VapBC complexes, the antitoxin forms a bent α-helix around the toxin

  • Binding mode variations:

    • The binding mode of VapB5 may differ from that seen in other organisms

    • In M. tuberculosis VapBC complexes, the antitoxin binds in a deep groove making multiple interactions with residues in the toxin's catalytic cavity

    • This interaction appears necessary for stringent control of highly toxic VapC components

  • Conservation analysis:

    • Pairwise comparison of related antitoxins (e.g., VapB4 and VapB5) shows conservation of many toxin-binding residues

    • Shape complementarity analysis of VapBC complexes reveals variation in interface complementarity (Sc scores ranging from ~0.59 to 0.74)

    • Cross-reactivity potential exists between certain VapB/VapC pairs based on structural similarity

What role does M. jannaschii VapB5 play in stress response and adaptations to extreme environments?

While specific details about M. jannaschii VapB5's role in stress response aren't explicitly stated in the search results, insights can be drawn from related research:

  • Regulation during stress:

    • In similar systems, nutrient stress or antibiotic treatment leads to protease-dependent decrease in VapB levels

    • This degradation releases VapC to exert its toxicity

    • The toxin-antitoxin ratio is important for cooperative DNA binding and transcriptional control

  • Adaptation to extreme conditions:

    • M. jannaschii lives in deep-sea hydrothermal vents at temperatures approaching boiling point

    • The VapBC system likely contributes to survival under these extreme conditions

    • Regulated growth arrest through toxin activity may be beneficial during stress periods

  • Potential metabolic control:

    • VapC toxins in other organisms target specific RNAs including tRNAs and rRNAs

    • This targeting can lead to controlled inhibition of translation

    • Such regulation may allow fine-tuning of metabolism in response to environmental changes

    • In some cases, VapC toxins can dramatically upregulate specific cellular processes, such as synthesis of transcription factors or ribosomes

  • Evolutionary significance:

    • M. jannaschii performs a respiratory metabolism that is about 3.5 billion years old

    • The VapBC system may represent an ancient regulatory mechanism

    • Studying this system provides insights into early life adaptation strategies

What are the optimal conditions for expressing recombinant M. jannaschii VapB5 in E. coli?

Based on related studies with M. jannaschii proteins, researchers can optimize expression using these methodological approaches:

  • Vector selection and construction:

    • Use vectors like pet22b+ for C-terminal His-tagged protein expression in E. coli

    • Design primers that amplify the full vapB5 gene with appropriate restriction sites

    • Clone the gene into the expression vector with a suitable tag for purification

  • Expression protocol:

    • Transform expression construct into an E. coli strain optimized for protein expression

    • Grow cultures to appropriate density before induction

    • Consider lower induction temperatures (25-30°C) to improve folding of thermophilic proteins

    • Optimize induction time and inducer concentration through small-scale expression tests

    • Harvest cells by centrifugation and store pellets at -80°C until purification

  • Purification strategy:

    • Lyse cells in an appropriate buffer (typically Tris-based with salt)

    • Use heat treatment (60-70°C) as an initial purification step to denature E. coli proteins

    • Purify using nickel affinity chromatography for His-tagged proteins

    • Consider additional purification steps (ion exchange, size exclusion) as needed

    • Assess purity by SDS-PAGE

  • Co-expression with VapC:

    • For functional studies, consider co-expressing VapB5 with its cognate toxin VapC

    • This may improve stability and solubility of both proteins

    • Design constructs that allow differential induction of toxin and antitoxin

How can researchers study the DNA-binding properties of M. jannaschii VapB5?

To characterize the DNA-binding properties of VapB5, which likely binds to the promoter region of the vapBC operon, the following methods can be employed:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Generate fluorescently labeled or radiolabeled DNA fragments containing the putative VapB5 binding site

    • Incubate with purified VapB5 alone or VapBC5 complex in binding buffer

    • Analyze binding by native PAGE

    • Include controls such as non-specific DNA and competitor DNA

  • DNase I footprinting:

    • Map specific DNA binding sites protected by VapB5

    • Use end-labeled DNA fragments containing the vapBC promoter region

    • Treat with DNase I after protein binding

    • Analyze protected regions by sequencing gel electrophoresis

  • Chromatin Immunoprecipitation (ChIP):

    • If working with whole cells, use ChIP to identify in vivo binding sites

    • Cross-link DNA-protein complexes

    • Immunoprecipitate with antibodies against VapB5 (or its tag)

    • Identify bound DNA sequences by sequencing

  • Surface Plasmon Resonance (SPR):

    • Immobilize DNA fragments on sensor chips

    • Measure binding kinetics of VapB5 to DNA

    • Determine association and dissociation constants

    • Test binding under various conditions (salt, pH, temperature)

What approaches can be used to identify potential cross-reactivity between M. jannaschii VapB5 and non-cognate VapC toxins?

To investigate potential cross-reactivity between VapB5 and non-cognate VapC toxins, researchers can employ these approaches:

  • Structural modeling and analysis:

    • Generate homology models of VapB5-VapC complexes

    • Calculate shape complementarity scores (Sc) and interaction energies

    • Compare conservation of toxin-binding residues between different VapB antitoxins

    • Predict potential cross-reactive pairs based on structural features

  • In vitro binding assays:

    • Express and purify VapB5 and various VapC toxins

    • Perform pull-down assays using tagged proteins

    • Measure binding affinities using isothermal titration calorimetry (ITC)

    • Use surface plasmon resonance (SPR) to determine binding kinetics

  • Functional neutralization assays:

    • Test ability of VapB5 to neutralize ribonuclease activity of different VapC toxins

    • Use fluorescent RNA substrates to monitor cleavage inhibition

    • Compare inhibition efficiency across different VapB-VapC pairs

  • Co-expression studies:

    • Co-express VapB5 with non-cognate VapC toxins in a suitable host

    • Assess growth rescue as an indicator of cross-neutralization

    • Use inducible promoters to control expression levels of toxin and antitoxin

    • Monitor protein-protein interactions using two-hybrid systems or FRET

How does temperature affect the stability and function of recombinant M. jannaschii VapB5?

M. jannaschii is a hyperthermophile that grows optimally at around 80°C, suggesting its proteins, including VapB5, are adapted to high temperatures. Researchers should consider:

  • Thermal stability assessment:

    • Use differential scanning calorimetry (DSC) to determine melting temperature

    • Perform circular dichroism (CD) at different temperatures to monitor structural changes

    • Compare activity after incubation at various temperatures (37°C, 60°C, 80°C, 100°C)

    • Consider that M. jannaschii proteins retain activity even after incubation at 80°C for extended periods

  • Functional temperature range:

    • Test DNA-binding activity at different temperatures

    • Examine toxin-neutralization capacity across a temperature gradient

    • Consider that optimal functional temperature may differ from growth temperature

    • Remember that while the native protein functions at high temperatures, recombinant protein expressed in E. coli may have different properties

  • Buffer considerations:

    • Use buffers with high thermal stability (phosphate or HEPES rather than Tris)

    • Adjust pH accounting for temperature-dependent changes

    • Include stabilizing agents like glycerol or salt when working at lower temperatures

    • Consider that some components like DTT are unstable at high temperatures

  • Storage implications:

    • Establish whether cold storage affects protein structure and function

    • Determine if freeze-thaw cycles are more detrimental to thermophilic proteins

    • Consider room temperature storage options for short-term use

How can M. jannaschii VapB5 research contribute to understanding evolutionary aspects of toxin-antitoxin systems?

M. jannaschii VapB5 research offers unique evolutionary insights:

  • Ancient regulatory mechanisms:

    • M. jannaschii performs a respiratory metabolism that is approximately 3.5 billion years old

    • The VapBC system may represent an ancient regulatory mechanism preserved in this evolutionary deeply-rooted organism

    • Comparing VapBC systems across archaea, bacteria, and eukaryotes can reveal evolutionary paths of toxin-antitoxin systems

  • Adaptation to extreme environments:

    • Study how the VapBC system contributes to survival in extreme conditions similar to early Earth

    • Examine differences between thermophilic and mesophilic TA systems

    • Investigate how these systems helped early life forms adapt to changing environmental conditions

  • Genomic context analysis:

    • Compare genomic organization of vapBC operons across different species

    • Identify conserved regulatory elements

    • Trace horizontal gene transfer events involving TA systems

    • Determine if TA systems co-evolved with other cellular systems

  • Structural evolution:

    • Compare structure-function relationships across archaeal, bacterial, and eukaryotic TA systems

    • Identify conserved binding motifs and interaction surfaces

    • Trace the evolution of specificity in toxin-antitoxin pairs

What techniques can be used to determine the three-dimensional structure of M. jannaschii VapB5?

Determining the 3D structure of VapB5 would provide valuable insights into its function. Researchers can use:

  • X-ray crystallography:

    • Express and purify VapB5 alone or in complex with VapC5

    • Screen crystallization conditions (e.g., ammonium sulphate, sodium formate, sodium cacodylate)

    • Consider oil microbatch-under-oil crystallization methods for improved crystal quality

    • Process diffraction data using software like iMOSFLM and SCALA

    • Solve structure using molecular replacement with related VapB structures as search models

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Particularly useful if VapB5 alone is difficult to crystallize

    • Express isotopically labeled protein (¹⁵N, ¹³C)

    • Acquire multi-dimensional NMR spectra

    • Assign resonances and calculate structure using distance constraints

    • This approach may be particularly suitable for studying the flexible regions of VapB5

  • Cryo-electron microscopy (cryo-EM):

    • Especially valuable for the VapBC5 complex

    • Prepare samples on grids and vitrify

    • Collect and process imaging data

    • Generate 3D reconstructions

    • Particularly useful for larger complexes or those resistant to crystallization

  • Computational structure prediction:

    • Use homology modeling based on related VapB structures

    • Validate models using molecular dynamics simulations

    • Assess models using metrics like shape complementarity (Sc) scores

    • This approach can provide preliminary structural insights while experimental structures are being determined

How can researchers distinguish between the regulatory functions of free VapB5 versus the VapB5-VapC complex?

Understanding the differential functions of free VapB5 versus the VapB5-VapC complex requires specific experimental approaches:

  • DNA binding studies with separated components:

    • Express and purify VapB5 alone and VapBC5 complex separately

    • Compare DNA binding affinities and specificities using EMSA or SPR

    • Map binding sites using footprinting assays

    • Determine if binding sites and affinities differ between VapB5 alone and the complex

  • Transcriptional reporter assays:

    • Construct reporter systems with the vapBC promoter

    • Express varying ratios of VapB5 and VapC to alter complex formation

    • Measure transcriptional output under different conditions

    • This can reveal how the toxin:antitoxin ratio affects transcriptional regulation

  • In vivo studies using the M. jannaschii genetic system:

    • Generate strains with altered VapB5:VapC ratios

    • Analyze transcriptional responses using RNA-seq

    • Monitor growth phenotypes under various stress conditions

    • This approach leverages the recently developed genetic system for M. jannaschii

  • Structural dynamics analysis:

    • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of VapB5 with altered dynamics when bound to VapC

    • Perform NMR studies to observe structural changes upon complex formation

    • These approaches can reveal how binding to VapC alters VapB5 conformation and potentially its DNA-binding properties

What proteomics approaches can be used to study VapB5 interactions and degradation during stress responses?

To understand VapB5 interactions and degradation during stress responses, researchers can employ:

  • Quantitative proteomics to track VapB5 levels:

    • Use stable isotope labeling (SILAC or TMT) to quantify protein changes

    • Track VapB5 levels under various stress conditions

    • Identify conditions that trigger VapB5 degradation

    • Compare with similar studies in other organisms where nutrient stress or antibiotics lead to protease-dependent decrease in VapB levels

  • Protein-protein interaction mapping:

    • Use affinity purification coupled with mass spectrometry (AP-MS)

    • Perform BioID or APEX proximity labeling to identify proteins in close proximity to VapB5

    • Conduct cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

    • These approaches can identify not only the VapC toxin but also proteases and other regulatory proteins that interact with VapB5

  • Pulse-chase experiments:

    • Label newly synthesized proteins with azide-containing amino acid analogs like azidohomoalanine (AHA)

    • Use click chemistry to capture labeled proteins

    • Quantify VapB5 degradation rates under different conditions

    • This approach has been used successfully to study protein synthesis dynamics in similar systems

  • Targeted protease studies:

    • Identify proteases responsible for VapB5 degradation (e.g., Lon protease in similar systems)

    • Create protease mutants using the M. jannaschii genetic system

    • Monitor VapB5 stability in these mutants under stress conditions

    • This can confirm the specific proteolytic mechanisms regulating the VapBC system

What are the critical parameters for successful reconstitution of active VapB5 from lyophilized powder?

For optimal reconstitution of active VapB5:

  • Pre-reconstitution handling:

    • Allow the vial to equilibrate to room temperature before opening

    • Briefly centrifuge to collect all material at the bottom

    • Avoid exposure to moisture before reconstitution

  • Buffer selection considerations:

    • Standard reconstitution uses deionized sterile water

    • For specific applications, consider Tris/PBS-based buffer, pH 8.0

    • Include 6% trehalose as a stabilizing agent

    • For functional studies, ensure buffer compatibility with downstream applications

  • Concentration optimization:

    • Reconstitute to 0.1-1.0 mg/mL as recommended

    • For higher concentrations, test solubility limits

    • Monitor for aggregation using dynamic light scattering

    • If precipitation occurs, reduce concentration or adjust buffer conditions

  • Storage preparation:

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Store long-term aliquots at -20°C/-80°C

How can researchers troubleshoot low expression or insolubility issues when producing recombinant M. jannaschii VapB5?

When facing expression or solubility challenges:

  • Codon optimization strategies:

    • M. jannaschii uses different codon preferences than E. coli

    • Consider synthesizing a codon-optimized gene

    • Co-express with rare tRNA-encoding plasmids (e.g., pRARE)

    • Test different E. coli expression strains

  • Expression condition optimization:

    • Vary induction temperature (15-37°C)

    • Test different inducer concentrations

    • Extend expression time (overnight at lower temperatures)

    • Try auto-induction media which can improve yields of difficult proteins

  • Solubility enhancement approaches:

    • Co-express with VapC5 to form the naturally occurring complex

    • Use solubility-enhancing fusion tags (MBP, SUMO, etc.)

    • Add solubilizing agents to lysis buffer (mild detergents, increased salt)

    • Consider extracting from inclusion bodies with subsequent refolding if necessary

  • Expression construct modifications:

    • Test different tag positions (N-terminal vs. C-terminal)

    • Remove flexible regions that might promote aggregation

    • Express just the structured domains if full-length protein is problematic

    • Include additional purification tags for more efficient isolation

What controls and validation experiments are essential when studying VapB5-VapC interactions?

To ensure reliable results when studying VapB5-VapC interactions:

  • Protein quality controls:

    • Verify protein purity by SDS-PAGE and mass spectrometry

    • Confirm proper folding using circular dichroism

    • Assess oligomeric state using size exclusion chromatography

    • Check complex formation using native PAGE

  • Functional validation experiments:

    • Confirm VapC ribonuclease activity using appropriate RNA substrates

    • Verify VapB5's ability to inhibit VapC activity

    • Test specificity using unrelated RNA substrates and proteins

    • Include controls with catalytically inactive VapC mutants

  • Interaction specificity controls:

    • Compare binding with non-cognate VapC toxins

    • Test binding with unrelated proteins as negative controls

    • Verify that binding is not tag-dependent by testing different tag configurations

    • Conduct competition assays with unlabeled proteins

  • Buffer condition controls:

    • Test interactions under various salt concentrations

    • Assess pH dependence of interactions

    • Evaluate the impact of divalent cations (particularly Mg²⁺)

    • Include detergent controls as detergents in buffers can disrupt VapBC complexes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.