Recombinant VapB5 is a His-tagged protein derived from Methanocaldococcus jannaschii, a thermophilic methanogen isolated from deep-sea hydrothermal vents . The protein is classified as a putative antitoxin in the VapB family, which counteracts toxin proteins (e.g., VapC) in bacterial/archaeal toxin-antitoxin (TA) systems . Its recombinant form is engineered for research applications, with full-length sequence (1–107 amino acids) and high purity (>90% by SDS-PAGE) .
TA systems regulate bacterial/archaeal survival under stress. VapB5 likely antagonizes a VapC toxin, preventing nonspecific RNA degradation . In M. jannaschii, such systems may aid survival in extreme environments (e.g., high temperature, sulfide-rich vents) .
VapB5 is linked to pathways involving RNA processing and stress response, though specific interactions remain uncharacterized .
| Pathway | Putative Role | Related Proteins |
|---|---|---|
| RNA Stability | Regulation of mRNA/rRNA turnover | VapC, Smg6, Rrp44 |
| Stress Response | Protection against oxidative stress | Coenzyme F420-dependent enzymes |
SDS-PAGE: Used to validate purity and confirm successful expression .
ELISA Development: Potential use in antibody-based assays (e.g., detecting VapB5 in M. jannaschii lysates) .
Structural Studies: His-tag facilitates affinity chromatography for crystallization .
Recent advances in M. jannaschii genetic systems (e.g., gene knockout, tagged protein expression) enable future functional studies on VapB5 .
Functional Gaps: Direct evidence of VapB5’s antitoxin activity in M. jannaschii remains sparse.
Evolutionary Significance: Comparative studies with other VapB proteins could clarify its role in archaeal TA systems .
Biotechnological Potential: Engineering VapB5 for applications in RNA protection or stress tolerance in extremophiles.
Methanocaldococcus jannaschii VapB5 (vapB5) is a putative antitoxin protein that functions as part of a toxin-antitoxin (TA) system in this archaeal organism. M. jannaschii is particularly significant for evolutionary biology research because it:
Performs a respiratory metabolism that is approximately 3.5 billion years old
Lives in deep-sea hydrothermal vents under conditions similar to early Earth
Grows in the absence of light and oxygen at temperatures approaching boiling point
Serves as a model organism for understanding ancient metabolic pathways
VapB5 itself is significant as part of the VapBC toxin-antitoxin system that helps regulate growth and metabolism in extreme conditions. This system consists of a stable toxin (VapC) and a labile antitoxin (VapB) that neutralizes the toxin under normal conditions .
Recombinant M. jannaschii VapB5 has the following characteristics:
| Parameter | Details |
|---|---|
| Protein Length | Full Length (1-107 amino acids) |
| Tag | His (N-terminal) |
| Source for recombinant expression | E. coli |
| Amino Acid Sequence | MQGPVIIPLISTLGLSFLAILLAYKISFSVIGFINSTLPTTLFPSKPYMLFVKISTISPLTCPSLIILTPALTWSLTALSMAYLYSSYKPNTFFTLSKNVSSFLTTG |
| Form | Typically supplied as lyophilized powder |
| Purity | >90% as determined by SDS-PAGE |
VapB antitoxins generally consist of two functional domains:
An N-terminal region that binds to the promoter DNA of the TA operon
A C-terminal region that binds to the toxin and abolishes its toxicity
For optimal handling of recombinant VapB5:
Storage conditions: Store at -20°C/-80°C upon receipt
Preparation before use: Briefly centrifuge the vial before opening to bring contents to the bottom
Reconstitution protocol:
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add 5-50% glycerol (final concentration) for long-term storage
Aliquot to avoid repeated freeze-thaw cycles
Working storage: Store working aliquots at 4°C for up to one week
Stability considerations: Repeated freezing and thawing is not recommended
Common techniques for studying VapB5 include:
SDS-PAGE: For purity assessment and basic characterization
Western blotting: For detection using His-tag antibodies
Protein-protein interaction assays: To study VapB5-VapC5 interactions
Circular dichroism (CD): To analyze secondary structure
Functional assays: To evaluate antitoxin activity
Researchers should note that VapB5 is typically studied in the context of its interaction with its cognate toxin VapC5, as the biological relevance lies in understanding the toxin-antitoxin system as a whole .
VapB5 interacts with VapC through its C-terminal region to neutralize the toxin's activity. Based on studies of similar VapBC systems, several methodological approaches can be used to characterize these interactions:
Surface Plasmon Resonance (SPR):
Immobilize VapC5 on a CM5 sensor chip at approximately 750 response units
Use running buffer containing 10 mM HEPES (pH 7.5) and 150 mM NaCl
Observe association and dissociation for 300 and 500 seconds, respectively
Test multiple concentrations of VapB5 to determine binding kinetics
Regenerate the chip surface using multiple pulses of 10 mM NaOH
Co-crystallization studies:
Use specialized conditions (e.g., containing ammonium sulphate, sodium formate, sodium cacodylate)
Employ oil microbatch-under-oil crystallization methods for improved crystal quality
Process data using programs like iMOSFLM and SCALA
Solve structures using molecular replacement methods with related VapBC structures as search models
Binding mechanism insights:
In related VapBC systems, the antitoxin binding involves:
The VapBC toxin-antitoxin system regulates its own transcription through a negative feedback loop:
Autoregulation mechanism:
Regulatory dynamics:
Transcriptional response:
While the specific targets of M. jannaschii VapC have not been fully characterized in the search results, methodologies from related VapC studies can be applied:
5' RNA-seq approach:
This specialized RNA-seq method identifies RNAs cleaved by VapC on a genome-scale
Maps toxin cleavage sites to single-nucleotide resolution
Exploits the fact that VapC toxins generate a 5' monophosphate (-P) upon RNA cleavage
This 5'-P moiety distinguishes toxin-generated products from intact cellular RNAs
In vitro cleavage assays:
Using fluorescent-labeled RNA substrates in different buffers
Detecting fluorescence when substrate is cleaved by nuclease activity
Testing Mg²⁺-dependence of activity (typically in Tris buffer, pH 7.0 containing 150 mM NaCl)
Confirming specificity through controls with EDTA (which should abolish activity)
Comparative analysis of VapC targets:
Studies of related VapC toxins have shown:
Working with proteins from hyperthermophilic archaea presents unique challenges:
Expression system considerations:
E. coli is typically used for heterologous expression despite differences in codon usage and folding machinery
Temperature optimization is critical (M. jannaschii grows at ~80°C while E. coli grows at 37°C)
Expression vectors must be carefully selected (e.g., pet22b+ vector with C-terminal His-tags)
Complex stability issues:
Separation challenges:
Activity verification:
A genetic system for M. jannaschii allows manipulation of the organism's chromosome, enabling researchers to:
Create targeted genetic modifications:
Transformation methodology:
Selection system:
Advantages over other archaeal systems:
Comparative analysis of VapB5 with other antitoxins reveals interesting structural and functional insights:
Structural comparisons:
M. jannaschii VapB5 is a 107-amino acid protein with a predicted N-terminal DNA-binding domain and C-terminal toxin-binding domain
When comparing with mycobacterial VapB antitoxins, significant structural differences exist despite functional similarities
In some VapBC complexes, the antitoxin forms a bent α-helix around the toxin
Binding mode variations:
The binding mode of VapB5 may differ from that seen in other organisms
In M. tuberculosis VapBC complexes, the antitoxin binds in a deep groove making multiple interactions with residues in the toxin's catalytic cavity
This interaction appears necessary for stringent control of highly toxic VapC components
Conservation analysis:
Pairwise comparison of related antitoxins (e.g., VapB4 and VapB5) shows conservation of many toxin-binding residues
Shape complementarity analysis of VapBC complexes reveals variation in interface complementarity (Sc scores ranging from ~0.59 to 0.74)
Cross-reactivity potential exists between certain VapB/VapC pairs based on structural similarity
While specific details about M. jannaschii VapB5's role in stress response aren't explicitly stated in the search results, insights can be drawn from related research:
Regulation during stress:
Adaptation to extreme conditions:
Potential metabolic control:
VapC toxins in other organisms target specific RNAs including tRNAs and rRNAs
This targeting can lead to controlled inhibition of translation
Such regulation may allow fine-tuning of metabolism in response to environmental changes
In some cases, VapC toxins can dramatically upregulate specific cellular processes, such as synthesis of transcription factors or ribosomes
Evolutionary significance:
Based on related studies with M. jannaschii proteins, researchers can optimize expression using these methodological approaches:
Vector selection and construction:
Expression protocol:
Transform expression construct into an E. coli strain optimized for protein expression
Grow cultures to appropriate density before induction
Consider lower induction temperatures (25-30°C) to improve folding of thermophilic proteins
Optimize induction time and inducer concentration through small-scale expression tests
Harvest cells by centrifugation and store pellets at -80°C until purification
Purification strategy:
Lyse cells in an appropriate buffer (typically Tris-based with salt)
Use heat treatment (60-70°C) as an initial purification step to denature E. coli proteins
Purify using nickel affinity chromatography for His-tagged proteins
Consider additional purification steps (ion exchange, size exclusion) as needed
Co-expression with VapC:
To characterize the DNA-binding properties of VapB5, which likely binds to the promoter region of the vapBC operon, the following methods can be employed:
Electrophoretic Mobility Shift Assay (EMSA):
DNase I footprinting:
Map specific DNA binding sites protected by VapB5
Use end-labeled DNA fragments containing the vapBC promoter region
Treat with DNase I after protein binding
Analyze protected regions by sequencing gel electrophoresis
Chromatin Immunoprecipitation (ChIP):
If working with whole cells, use ChIP to identify in vivo binding sites
Cross-link DNA-protein complexes
Immunoprecipitate with antibodies against VapB5 (or its tag)
Identify bound DNA sequences by sequencing
Surface Plasmon Resonance (SPR):
To investigate potential cross-reactivity between VapB5 and non-cognate VapC toxins, researchers can employ these approaches:
Structural modeling and analysis:
In vitro binding assays:
Functional neutralization assays:
Co-expression studies:
M. jannaschii is a hyperthermophile that grows optimally at around 80°C, suggesting its proteins, including VapB5, are adapted to high temperatures. Researchers should consider:
Thermal stability assessment:
Use differential scanning calorimetry (DSC) to determine melting temperature
Perform circular dichroism (CD) at different temperatures to monitor structural changes
Compare activity after incubation at various temperatures (37°C, 60°C, 80°C, 100°C)
Consider that M. jannaschii proteins retain activity even after incubation at 80°C for extended periods
Functional temperature range:
Test DNA-binding activity at different temperatures
Examine toxin-neutralization capacity across a temperature gradient
Consider that optimal functional temperature may differ from growth temperature
Remember that while the native protein functions at high temperatures, recombinant protein expressed in E. coli may have different properties
Buffer considerations:
Use buffers with high thermal stability (phosphate or HEPES rather than Tris)
Adjust pH accounting for temperature-dependent changes
Include stabilizing agents like glycerol or salt when working at lower temperatures
Consider that some components like DTT are unstable at high temperatures
Storage implications:
M. jannaschii VapB5 research offers unique evolutionary insights:
Ancient regulatory mechanisms:
M. jannaschii performs a respiratory metabolism that is approximately 3.5 billion years old
The VapBC system may represent an ancient regulatory mechanism preserved in this evolutionary deeply-rooted organism
Comparing VapBC systems across archaea, bacteria, and eukaryotes can reveal evolutionary paths of toxin-antitoxin systems
Adaptation to extreme environments:
Genomic context analysis:
Structural evolution:
Determining the 3D structure of VapB5 would provide valuable insights into its function. Researchers can use:
X-ray crystallography:
Express and purify VapB5 alone or in complex with VapC5
Screen crystallization conditions (e.g., ammonium sulphate, sodium formate, sodium cacodylate)
Consider oil microbatch-under-oil crystallization methods for improved crystal quality
Process diffraction data using software like iMOSFLM and SCALA
Solve structure using molecular replacement with related VapB structures as search models
Nuclear Magnetic Resonance (NMR) spectroscopy:
Particularly useful if VapB5 alone is difficult to crystallize
Express isotopically labeled protein (¹⁵N, ¹³C)
Acquire multi-dimensional NMR spectra
Assign resonances and calculate structure using distance constraints
This approach may be particularly suitable for studying the flexible regions of VapB5
Cryo-electron microscopy (cryo-EM):
Especially valuable for the VapBC5 complex
Prepare samples on grids and vitrify
Collect and process imaging data
Generate 3D reconstructions
Particularly useful for larger complexes or those resistant to crystallization
Computational structure prediction:
Understanding the differential functions of free VapB5 versus the VapB5-VapC complex requires specific experimental approaches:
DNA binding studies with separated components:
Transcriptional reporter assays:
In vivo studies using the M. jannaschii genetic system:
Structural dynamics analysis:
Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of VapB5 with altered dynamics when bound to VapC
Perform NMR studies to observe structural changes upon complex formation
These approaches can reveal how binding to VapC alters VapB5 conformation and potentially its DNA-binding properties
To understand VapB5 interactions and degradation during stress responses, researchers can employ:
Quantitative proteomics to track VapB5 levels:
Use stable isotope labeling (SILAC or TMT) to quantify protein changes
Track VapB5 levels under various stress conditions
Identify conditions that trigger VapB5 degradation
Compare with similar studies in other organisms where nutrient stress or antibiotics lead to protease-dependent decrease in VapB levels
Protein-protein interaction mapping:
Use affinity purification coupled with mass spectrometry (AP-MS)
Perform BioID or APEX proximity labeling to identify proteins in close proximity to VapB5
Conduct cross-linking mass spectrometry (XL-MS) to identify interaction interfaces
These approaches can identify not only the VapC toxin but also proteases and other regulatory proteins that interact with VapB5
Pulse-chase experiments:
Label newly synthesized proteins with azide-containing amino acid analogs like azidohomoalanine (AHA)
Use click chemistry to capture labeled proteins
Quantify VapB5 degradation rates under different conditions
This approach has been used successfully to study protein synthesis dynamics in similar systems
Targeted protease studies:
Identify proteases responsible for VapB5 degradation (e.g., Lon protease in similar systems)
Create protease mutants using the M. jannaschii genetic system
Monitor VapB5 stability in these mutants under stress conditions
This can confirm the specific proteolytic mechanisms regulating the VapBC system
For optimal reconstitution of active VapB5:
Pre-reconstitution handling:
Buffer selection considerations:
Concentration optimization:
Storage preparation:
When facing expression or solubility challenges:
Codon optimization strategies:
Expression condition optimization:
Vary induction temperature (15-37°C)
Test different inducer concentrations
Extend expression time (overnight at lower temperatures)
Try auto-induction media which can improve yields of difficult proteins
Solubility enhancement approaches:
Expression construct modifications:
To ensure reliable results when studying VapB5-VapC interactions:
Protein quality controls:
Functional validation experiments:
Interaction specificity controls:
Buffer condition controls: