Recombinant Methanocaldococcus jannaschii Putative flagella-related protein G (flaG)

What is Methanocaldococcus jannaschii putative flagella-related protein G (flaG)?

Putative flagella-related protein G (flaG) is a protein encoded by the flaG gene (locus tag MJ0898) in Methanocaldococcus jannaschii. It is part of the flagellar operon that contains multiple flagella-related genes arranged in an operon-like structure. The protein has 154 amino acids with the sequence: MIYLASSAMSEIVMFVAVLLIAAFVAGILTTSTYKISLNINKKGDALATKLSQDFEIINDPGDIVRNSSAGTIALYIKNTGKDPIIFTNDSFTVIIDGSIVEINTTNQLTSPGSNILSPGDVGEIVVNYNETGYHRIKVISECGISRIIRGYIS . FlaG is considered part of the archaeal motility system, which shares similarities with bacterial type IV pili systems rather than bacterial flagella.

The protein is believed to contribute to the assembly and function of archaeal flagella (also called archaella), which are crucial for motility. In M. jannaschii, flagella expression is notably regulated by hydrogen partial pressure, representing the first documented example of hydrogen-dependent regulation of flagella expression in any domain of life .

How does the structure of flaG compare to other flagella-related proteins in M. jannaschii?

The flagellar system in M. jannaschii involves several proteins including FlaB1, FlaB2, FlaB3, FlaD, FlaE, FlaF, FlaG, FlaH, FlaI, and FlaJ, arranged in an operon-like structure. While FlaB proteins are the major flagellins that form the filament structure, FlaG is considered a minor accessory protein that likely plays a regulatory or structural role in flagella assembly .

Unlike FlaB2 and FlaB3, which have been identified as components of the flagellar filament (with FlaB2 being the major flagellin), FlaG has not been detected in purified flagellar filaments. This suggests that FlaG may function in the membrane component of the flagellar apparatus or in the assembly process rather than forming part of the external filament structure .

What techniques are commonly used to express and purify recombinant flaG?

Expression Systems:

• E. coli-based expression: The flaG gene can be cloned into expression vectors like pET series with appropriate tags (His-tag, FLAG-tag) for purification.

• Archaeal expression systems: For more native conditions, expression in related archaeal hosts using shuttle vectors may be employed.

Purification Protocol:

• Cell lysis under denaturing conditions (8M urea) or native conditions with detergents

• Affinity chromatography using Ni-NTA for His-tagged proteins or anti-FLAG resins for FLAG-tagged proteins

• Size exclusion chromatography to remove aggregates

• Ion exchange chromatography for further purification

Table 1: Typical Buffer Conditions for flaG Purification

The recombinant protein is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage. Repeated freezing and thawing is not recommended, and working aliquots should be kept at 4°C for up to one week .

How can researchers effectively study hydrogen-dependent regulation of flagella-related proteins including flaG?

To study hydrogen-dependent regulation of flagella-related proteins in M. jannaschii, researchers can employ a bioreactor system with precise control of hydrogen partial pressure (pH2). The following methodological approach can be implemented:

• Cultivation conditions:

  • High hydrogen condition: pH2 at approximately 178 kPa (high hydrogen)

  • Low hydrogen condition: pH2 at approximately 650 Pa (ultralow hydrogen)

  • Temperature maintained at 85°C (optimal growth temperature)

  • Growth medium containing minerals, vitamins, and CO2 as carbon source

• Sampling and analysis:

  • Harvest cells at different growth phases

  • Extract proteins and perform 2D-gel electrophoresis

  • Identify and quantify flagella-related proteins including FlaG

  • Compare protein levels between high and low hydrogen conditions

• Verification:

  • Conduct pH2-shift experiments (changing from high to low or vice versa)

  • Perform electron microscopy to correlate protein levels with flagella presence

  • Use quantitative PCR to measure transcript levels

This approach enables researchers to observe that under high hydrogen partial pressure and low cell density (hydrogen-excess condition), M. jannaschii cells exhibit low or undetectable levels of flagella-related proteins. Conversely, flagella synthesis occurs when hydrogen becomes limiting either at high cell density under high pH2 or at low cell density under low pH2 .

What immunological methods are most effective for detecting flaG in cell samples?

Recommended Immunological Methods for flaG Detection:

• Western Blotting:

  • Sample preparation: Cells lysed in buffer containing 1% SDS, 50 mM Tris-HCl (pH 8.0), and protease inhibitors

  • Protein separation: 12-15% SDS-PAGE gels recommended due to flaG's low molecular weight

  • Transfer: PVDF membranes with semi-dry transfer (15V, 30 minutes)

  • Blocking: 5% non-fat milk in TBST buffer (pH 7.4)

  • Primary antibody: Anti-flaG (1:1000) or anti-FLAG for tagged versions (1:5000)

  • Secondary antibody: HRP-conjugated anti-rabbit/mouse IgG (1:10000)

  • Detection: Enhanced chemiluminescence

• Immunofluorescence:

  • Cell fixation: 4% paraformaldehyde for 20 minutes at room temperature

  • Permeabilization: 0.1% Triton X-100 in PBS for 15 minutes

  • Blocking: 3% BSA in PBS for 1 hour

  • Primary antibody: Anti-flaG (1:100) or anti-FLAG for tagged versions (1:500)

  • Secondary antibody: Fluorophore-conjugated anti-rabbit/mouse IgG (1:500)

  • Counterstaining: DAPI for nucleic acid visualization

  • Mounting: Anti-fade mounting medium

• ELISA:

  • Plate coating: Recombinant flaG (5-10 μg/ml) in coating buffer overnight at 4°C

  • Blocking: 3% BSA in PBST for 2 hours at room temperature

  • Primary antibody: Serial dilutions of test antibody or serum

  • Secondary antibody: HRP-conjugated anti-species IgG

  • Substrate: TMB substrate solution

  • Detection: Absorbance at 450 nm after stopping reaction with 2N H2SO4

For advanced visualization, super-resolution microscopy techniques like 3D-STORM can be employed with CF647 NHS ester labeling or by implementing immunofluorescence labeling with 3xFLAG-tagged flaG strains .

How can genetic modification approaches be used to study flaG function?

Genetic modification of M. jannaschii to study flaG function requires specialized approaches due to the extreme growth conditions of this hyperthermophilic archaeon. The following methodology can be employed:

• Knockout/Knockdown Strategy:

  • Design homologous regions (~500 bp) flanking the flaG gene

  • Clone these regions into a suitable vector (e.g., pBluescript II SK(+))

  • Insert a selectable marker between the homologous regions

  • Transform M. jannaschii using established protocols

  • Select transformants using appropriate antibiotics (e.g., mevinolin)

  • Verify gene disruption via PCR and sequencing

• Tagged Protein Expression:

  • Amplify the flaG gene with appropriate restriction sites

  • Clone into an expression vector with a promoter active in M. jannaschii (e.g., P-sla)

  • Add a tag sequence (3xFLAG tag, His-tag) for detection and purification

  • Transform into M. jannaschii

  • Verify expression via Western blot or immunofluorescence

• Cultivation and Phenotypic Analysis:

  • Grow transformants in anaerobic canisters pressurized with H2:CO2 (80:20 v/v) to 3×105 Pa

  • Incubate at 80°C

  • Compare motility, cell morphology, and flagella formation with wild-type

  • Analyze growth rates under varying hydrogen partial pressures

Successful genetic modification allows researchers to observe the effects of flaG absence or overexpression on flagella formation, cell motility, and response to hydrogen limitation, providing insights into its functional role in M. jannaschii .

How does hydrogen partial pressure affect flaG expression compared to other flagella-related proteins?

The regulation of flagella-related proteins by hydrogen partial pressure represents a unique control mechanism in M. jannaschii. Comparative proteome analysis reveals distinct patterns of expression among flagella-related proteins:

Table 2: Effect of Hydrogen Partial Pressure on Flagella-Related Protein Expression

While specific data on FlaG expression is limited in the provided search results, the operon-like arrangement of the fla genes in M. jannaschii suggests that FlaG expression likely follows patterns similar to other Fla proteins. The well-concerted changes observed in the levels of FlaB2, FlaB3, FlaD, and FlaE indicate that flaG regulation is likely coordinated with these proteins .

This hydrogen-dependent regulation is not a cell density-dependent phenomenon, as cells from both low-density cultures under low hydrogen conditions and high-density cultures under high hydrogen conditions exhibit high levels of Fla polypeptides. The specific mechanism by which M. jannaschii senses hydrogen concentration remains to be elucidated, but the organism is capable of sensing subtle changes in dissolved hydrogen concentration, suggesting an exceptionally sensitive, efficient, and fast-acting signal-sensing and signal-transmission system .

What are the current hypotheses regarding the specific function of flaG in archaeal flagella assembly?

Several hypotheses exist regarding the specific function of flaG in archaeal flagella assembly, though definitive experimental validation remains limited:

• Assembly Regulation Hypothesis:

  • FlaG may function as a regulator of flagella assembly, controlling the timing or extent of filament growth

  • It could serve as a checkpoint protein that ensures proper assembly sequence

  • It might coordinate assembly with environmental conditions (hydrogen availability)

• Structural Component Hypothesis:

  • FlaG may serve as an adapter between the membrane-embedded motor complex and the external filament

  • It could contribute to the structure of the basal body or motor complex

  • It might function as a component of the secretion apparatus for flagellin export

• Signal Transduction Hypothesis:

  • FlaG may participate in sensing hydrogen levels and transmitting this signal to the flagella assembly machinery

  • It could interact with other sensory or regulatory proteins to coordinate flagella expression with metabolic state

  • It might serve as an intermediate in a phosphorylation cascade or other signaling pathway

• Chaperone-Like Function Hypothesis:

  • FlaG could function as a specialized chaperone for flagellin subunits

  • It might prevent premature assembly or aggregation of flagellins

  • It could assist in proper folding of flagellins under extreme temperature conditions

These hypotheses remain to be tested through detailed structural, genetic, and biochemical analyses. The operon-like arrangement of fla genes and the co-regulation of multiple Fla proteins suggest that FlaG works in concert with other flagella-related proteins as part of an integrated system .

How can advanced imaging techniques be applied to study flaG localization and dynamics?

Advanced imaging techniques offer powerful approaches to study flaG localization and dynamics in M. jannaschii. Recent developments in super-resolution microscopy provide unprecedented insights into protein localization at the nanoscale:

• 3D-STORM (Stochastic Optical Reconstruction Microscopy):

  • Resolution: Achieves ~20 nm resolution by precisely locating individual fluorescent molecules

  • Sample preparation: Cells can be labeled using CF647 NHS ester for general protein labeling

  • Immunolabeling approach: Create 3xFLAG-tagged flaG strain and use anti-FLAG antibodies for specific detection

  • Analysis: Software like ThunderSTORM or STORM-Analysis can be used to reconstruct super-resolution images

  • Applications: Visualize the distribution of flaG relative to other flagellar components or cellular structures

  • Advantages: Allows visualization of protein distribution without the limitations of electron microscopy sample preparation

• Two-Color STORM Imaging:

  • Methodology: Combine flaG labeling with labeling of other cellular components (e.g., DNA)

  • Implementation: Use spectrally distinct fluorophores that can be activated and imaged sequentially

  • Analysis: Examine co-localization patterns and spatial relationships between flaG and other cellular structures

  • Applications: Determine if flaG associates with specific cellular regions or other flagellar components

  • Advantages: Provides context for flaG localization within the cell

• Time-Resolved Imaging:

  • Approach: Use photo-activatable fluorescent proteins or dyes with time-lapse imaging

  • Implementation: Create fusion proteins with photo-convertible tags for pulse-chase experiments

  • Analysis: Track movement and redistribution of flaG under different conditions

  • Applications: Examine dynamic responses of flaG to changes in hydrogen partial pressure

  • Advantages: Captures temporal dynamics of protein redistribution

These advanced imaging techniques can reveal the widespread distribution of flaG structures within M. jannaschii cells and provide insights into their association with other cellular components, significantly enhancing our understanding of flaG function in archaeal flagella assembly and regulation .

How should researchers interpret contradictory results in flaG expression studies?

When encountering contradictory results in flaG expression studies, researchers should consider several factors that might explain the discrepancies:

• Growth Condition Variations:

  • Hydrogen partial pressure: Even small variations in pH2 can significantly affect expression

  • Growth phase: Expression patterns may change dramatically between early, mid, and late exponential phases

  • Culture density: Cell density effects may modify hydrogen sensing or response

  • Temperature fluctuations: Small deviations from optimal growth temperature (85°C) may alter expression profiles

• Methodological Considerations:

  • Protein extraction efficiency: Different extraction methods may preferentially recover certain protein populations

  • Antibody specificity: Cross-reactivity issues may lead to false positive or negative results

  • Detection sensitivity: Different methods have varying detection limits that might miss low-level expression

  • Post-translational modifications: These may affect antibody recognition or protein stability

• Strain Variations:

  • Laboratory evolution: Long-term cultivation may select for regulatory mutations

  • Contamination: Mixed cultures may show inconsistent results

  • Genetic background: Different strains may have altered regulatory mechanisms

Recommended Resolution Approach:

• Implement standardized growth conditions with precise monitoring of hydrogen levels

• Use multiple detection methods (Western blot, qPCR, mass spectrometry)

• Include appropriate controls (other regulated proteins like MTD and HMDX)

• Perform time-course experiments to capture dynamic changes

• Consider single-cell analyses to address population heterogeneity

The hydrogen regulation of flagella-related proteins in M. jannaschii has been observed to parallel previously characterized hydrogen-dependent behaviors of other proteins (MTD and HMDX), which can serve as internal controls to validate experimental conditions .

What are the main technical challenges in working with recombinant flaG and how can they be addressed?

Working with recombinant flaG from M. jannaschii presents several technical challenges due to the hyperthermophilic nature of the source organism and the properties of the protein itself:

• Protein Solubility Issues:

  • Challenge: Recombinant flaG may form inclusion bodies or aggregate when expressed in mesophilic hosts

  • Solution:

    • Use fusion tags that enhance solubility (MBP, SUMO, thioredoxin)

    • Express at lower temperatures (16-20°C)

    • Include mild detergents (0.05% Tween-20) in purification buffers

    • Consider on-column refolding during purification

• Protein Stability Concerns:

  • Challenge: flaG may be unstable under standard laboratory conditions

  • Solution:

    • Store in stabilizing buffers with 50% glycerol

    • Avoid repeated freeze-thaw cycles

    • Use protease inhibitors during all handling steps

    • Consider adding reducing agents if cysteine residues are present

• Expression System Limitations:

  • Challenge: Standard E. coli expression systems may not produce properly folded protein

  • Solution:

    • Try archaeal expression hosts for more native-like folding

    • Use E. coli strains with additional chaperones

    • Consider cell-free expression systems with archaeal components

• Functional Assays Development:

  • Challenge: Functional assays for flaG are not well-established

  • Solution:

    • Develop in vitro assembly assays with other flagellar components

    • Use binding assays to identify interaction partners

    • Consider structural studies to inform functional hypotheses

Table 3: Recommended Optimization Strategies for Recombinant flaG Production

These approaches can significantly improve the yield and quality of recombinant flaG, enabling more reliable and reproducible research outcomes .

How can researchers effectively correlate flaG expression with flagellar assembly and function?

To effectively correlate flaG expression with flagellar assembly and function, researchers should implement a multi-faceted approach that combines molecular, structural, and functional analyses:

• Quantitative Expression Analysis:

  • qRT-PCR to measure flaG transcript levels under different conditions

  • Western blotting with densitometry to quantify protein levels

  • Mass spectrometry-based proteomics for absolute quantification

  • Time-course analysis to track expression dynamics following stimulus

• Structural Characterization:

  • Electron microscopy to assess flagella formation and structure

  • Immunogold labeling to localize flaG within the cell or flagellar apparatus

  • Super-resolution microscopy (3D-STORM) to visualize protein distribution

  • Correlative light and electron microscopy to connect protein localization with ultrastructure

• Functional Assays:

  • Motility assays on semi-solid media to quantify swimming ability

  • Video microscopy to measure swimming speed and pattern

  • Microfluidic devices to assess chemotactic responses

  • Adherence assays to assess potential roles in attachment

• Genetic Manipulation:

  • Construction of conditional expression strains (inducible promoters)

  • Creation of fluorescent protein fusions for live-cell imaging

  • Site-directed mutagenesis to identify critical functional residues

  • Complementation studies with wild-type and mutant variants

• Data Integration Framework:

  • Statistical correlation analyses between expression levels and phenotypic measures

  • Mathematical modeling of the relationship between protein abundance and function

  • Principal component analysis to identify key variables affecting assembly

  • Machine learning approaches to identify patterns in complex datasets

By systematically applying these approaches, researchers can establish cause-effect relationships between flaG expression, flagellar assembly, and archaeal motility. The comprehensive data set would allow for developing predictive models of how factors like hydrogen partial pressure influence the entire process from gene expression to functional output .

What emerging technologies could advance our understanding of flaG function?

Several emerging technologies hold promise for advancing our understanding of flaG function in M. jannaschii:

• Cryo-Electron Tomography:

  • Application: Visualize native flagellar structures in situ at near-atomic resolution

  • Advantage: Preserves cellular context without artifacts from sample preparation

  • Implementation: Flash-freeze cells at different stages of flagella assembly

  • Expected insights: Detailed structural information about flaG incorporation into the flagellar complex

• Single-Molecule Tracking:

  • Application: Track movement and interactions of individual flaG molecules in living cells

  • Advantage: Captures dynamic behaviors not visible in population averages

  • Implementation: HaloTag or SNAP-tag fusions with minimal impact on protein function

  • Expected insights: Real-time visualization of flaG trafficking and incorporation into flagella

• Proximity Labeling Proteomics:

  • Application: Identify proteins that interact with or are located near flaG

  • Advantage: Captures weak or transient interactions missed by traditional methods

  • Implementation: APEX2 or BioID fusions to flaG expressed in M. jannaschii

  • Expected insights: Comprehensive interactome of flaG, revealing functional associations

• AlphaFold2 and Structure Prediction:

  • Application: Generate high-confidence structural models of flaG and its complexes

  • Advantage: Provides structural insights without crystallization

  • Implementation: Computational modeling followed by experimental validation

  • Expected insights: Structural features that inform function and mechanism

• CRISPR-Based Genetic Tools for Archaea:

  • Application: Precise genome editing to create conditional or regulated flaG variants

  • Advantage: More efficient genetic manipulation than traditional methods

  • Implementation: Adapt CRISPR systems to function at high temperatures

  • Expected insights: Direct testing of functional hypotheses through controlled genetic perturbation

These technologies, when applied in combination, could provide unprecedented insights into how flaG contributes to flagellar assembly and function in hyperthermophilic archaea, potentially revealing principles that apply across archaeal species .

What are the implications of understanding flaG for biotechnology applications?

Understanding the structure, function, and regulation of flaG in M. jannaschii has several potential implications for biotechnology applications:

• Thermostable Protein Engineering:

  • Application: Design of proteins stable at extreme temperatures

  • Mechanism: Identification of structural features that confer thermostability to flaG

  • Potential uses: Industrial enzymes, biosensors functional at high temperatures

  • Advantage: Increased process efficiency, reduced cooling requirements

• Biosensing Applications:

  • Application: Development of hydrogen sensors for industrial or environmental monitoring

  • Mechanism: Utilizing the hydrogen-responsive regulatory system controlling flaG expression

  • Potential uses: Monitoring hydrogen in bioreactors, geological settings, or industrial processes

  • Advantage: High sensitivity to hydrogen at concentrations relevant to natural environments

• Nanobiotechnology:

  • Application: Self-assembling protein nanostructures

  • Mechanism: Exploiting the controlled assembly properties of archaeal flagellar proteins

  • Potential uses: Protein scaffolds, drug delivery systems, nanowires

  • Advantage: Precisely controllable assembly through environmental triggers

• Biofuel Production:

  • Application: Optimized hydrogen metabolism for biofuel production

  • Mechanism: Engineering hydrogen sensing and utilization pathways

  • Potential uses: Enhanced hydrogen production by engineered microorganisms

  • Advantage: Improved efficiency in hydrogen-based biofuel systems

• Extremozyme Development:

  • Application: Novel enzymes for extreme conditions

  • Mechanism: Identification of functional domains that operate at high temperatures

  • Potential uses: Biocatalysts for industrial processes at elevated temperatures

  • Advantage: Reduced contamination risk, increased reaction rates

Understanding the hydrogen-dependent regulation of flaG could inform the development of sophisticated biological systems responsive to specific environmental cues, expanding our toolkit for synthetic biology applications in extreme environments .

How might comparative studies of flaG across archaeal species contribute to evolutionary understanding?

Comparative studies of flaG across archaeal species could provide valuable insights into evolutionary processes and adaptation mechanisms:

• Evolutionary Conservation Patterns:

  • Research approach: Phylogenetic analysis of flaG sequences across archaeal phyla

  • Methodological consideration: Account for the high GC content of hyperthermophiles

  • Expected findings: Identification of conserved domains suggesting functional importance

  • Analysis tools: Maximum likelihood phylogenetic tree construction, selection pressure analysis

Table 4: Conservation Analysis of Key flaG Domains Across Representative Archaeal Species

*Conservation score based on amino acid sequence similarity relative to M. jannaschii flaG

• Adaptation to Extreme Environments:

  • Research approach: Correlation of flaG sequence features with habitat parameters

  • Methodological consideration: Include environmental metadata in analyses

  • Expected findings: Identification of amino acid substitutions associated with adaptation to specific conditions

  • Analysis tools: Statistical coupling analysis, ancestral sequence reconstruction

• Co-evolution with Other Flagellar Components:

  • Research approach: Analysis of co-evolutionary patterns across flagellar genes

  • Methodological consideration: Account for horizontal gene transfer events

  • Expected findings: Identification of co-evolving residues suggesting functional interactions

  • Analysis tools: Mutual information analysis, direct coupling analysis

• Regulatory Network Evolution:

  • Research approach: Compare hydrogen-responsive regulatory systems across methanogenic archaea

  • Methodological consideration: Include experimental validation of regulatory mechanisms

  • Expected findings: Determine if hydrogen regulation of flagella is conserved or divergent

  • Analysis tools: Comparative genomics of promoter regions, transcription factor binding sites

• Structural Adaptation Mechanisms:

  • Research approach: Combine structural predictions with stability analyses

  • Methodological consideration: Validate predictions with experimental stability measurements

  • Expected findings: Structural features conferring thermostability in hyperthermophiles

  • Analysis tools: Molecular dynamics simulations, Rosetta energy calculations

These comparative approaches would reveal how flaG has evolved across diverse archaeal lineages, providing insights into adaptation to extreme environments and the evolution of archaeal motility systems .