Recombinant Methanocaldococcus jannaschii Putative membrane protein MJ1562 (MJ1562)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Homology

While direct functional data for MJ1562 is limited, bioinformatic analyses reveal:

  • Domain Architecture: MMPL (PF03176) and AcrB-like transporter domains (SSF82866) . These are associated with small molecule transport and antimicrobial resistance in bacteria .

  • Pathway Associations: Hypothesized roles in membrane transport or stress response, though no specific pathways are experimentally confirmed .

  • Evolutionary Significance: Homology to Pseudomonas entomophila PSEEN2550 suggests conserved functions across prokaryotes .

Research Applications

MJ1562 is primarily used in:

  • Structural Studies: Thermostability from its archaeal origin makes it suitable for high-temperature crystallography .

  • Membrane Protein Engineering: Serves as a template for designing synthetic transporters .

  • Comparative Genomics: Highlights evolutionary divergence between archaeal and bacterial membrane systems .

Challenges and Future Directions

Key gaps in knowledge include:

  • Functional Validation: No in vivo studies confirm its role in M. jannaschii .

  • Interaction Partners: Direct interactors remain unidentified despite yeast two-hybrid screens .

  • Biophysical Properties: Thermostability and pressure tolerance under hyperthermophilic conditions are untested .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will strive to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate your needs in advance as additional fees will apply.
Notes
Avoid repeated freezing and thawing. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) is recommended and aliquoting for long-term storage at -20°C/-80°C is advisable. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. Should you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
MJ1562; Putative membrane protein MJ1562
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1562
Target Protein Sequence
MVVLMLREILKKVAHFSEQKPFLMLLIILIITVFAGISATNVKSQTAFEKMLPQDNPIIK TLYEVRDEFGGTDVITICIKLKPSDSSDKVVDIRDPRVLKAIKELEDNLRYVDGITSVSS PVDIIIQKNNGIVPNDIDTVKDILNKLPEDKRKRIFNSDYSMTVVNAYTDAGGDQKKLMR VMDDVNERIEETPFPPGVEVIATGTPPMRKLMDELMKESQSFTTTVGLIGILIILIIYFR KPLSSIMPLLPVLIAVIWTGGAMGLLDIPLDMATAGIGSLILGLGIDYGIHLMHRYDEER RKGMPIDKAIETAVVETGTAVMATTATTVVGFLALVLAPLPMMANLGKVCALGISFCMVV VLTLLPALIVIEERHIMPLIKRLKGDTQ
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1562

STRING: 243232.MJ_1562

Protein Families
Resistance-nodulation-cell division (RND) (TC 2.A.6) family, MmpL subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ1562 and what organism does it originate from?

MJ1562 is a putative membrane protein from Methanocaldococcus jannaschii, an evolutionary deeply rooted hyperthermophilic methanarchaeon. This protein consists of 388 amino acids and is classified as a membrane protein based on its structural domains and cellular localization . M. jannaschii is known for its adaptation to extreme environments, growing optimally at 80°C under anaerobic conditions with H₂ and CO₂ as methanogenesis substrates . Understanding this protein's role requires considering the unique physiological characteristics of its native archaeal host, which represents one of the phylogenetically deepest branches in the domain Archaea.

What are the basic structural features of MJ1562?

MJ1562 is characterized by specific structural domains associated with membrane transport functions. Bioinformatic analyses have identified several key features:

AnalysisAccessionDescriptionAmino Acid RangeE-value
PfamPF03176MMPL family476-7742.2E-27
SUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domain576-7764.84E-36
SUPERFAMILYSSF82866Multidrug efflux transporter AcrB transmembrane domain204-3922.88E-25
Gene3DG3DSA:1.20.1640.10Multidrug efflux transporter AcrB transmembrane domain195-3981.0E-18
PANTHERPTHR33406MEMBRANE PROTEIN MJ1562-RELATED1-7782.1E-78
Gene3DG3DSA:1.20.1640.10Multidrug efflux transporter AcrB transmembrane domain575-7811.3E-28

The presence of these domains suggests MJ1562 may function as a membrane transport protein, potentially involved in substrate translocation across the archaeal cell membrane . The protein appears to share structural similarities with bacterial multidrug efflux transporters, though its specific archaeal function may differ significantly.

What expression systems are effective for producing recombinant MJ1562?

Recombinant MJ1562 has been successfully expressed in E. coli expression systems, typically with a His-tag to facilitate purification . When expressing archaeal membrane proteins like MJ1562, several methodological considerations must be addressed:

  • Codon optimization for the expression host is often necessary due to the significant differences in codon usage between archaea and bacteria

  • Expression temperature should be carefully controlled, often lower than the normal growth temperature for E. coli (typically 16-25°C), to facilitate proper folding

  • Selection of appropriate promoter systems (such as T7 or arabinose-inducible promoters) with tight regulation to prevent toxicity

  • Use of specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or Lemo21(DE3))

The full-length protein (amino acids 1-388) has been successfully expressed with a His-tag, indicating that the entire protein sequence can be produced in recombinant form despite potential challenges associated with membrane protein expression .

What are the optimal methods for purifying MJ1562?

Purification of membrane proteins like MJ1562 requires specialized techniques due to their hydrophobic nature and tendency to aggregate. A methodological approach would include:

  • Membrane fraction isolation through differential centrifugation following cell lysis

  • Solubilization using appropriate detergents (commonly used options include n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin)

  • Affinity chromatography utilizing the His-tag (IMAC - Immobilized Metal Affinity Chromatography)

  • Size exclusion chromatography to remove aggregates and ensure protein homogeneity

  • Protein quality assessment through techniques such as SDS-PAGE, Western blotting, and mass spectrometry

For hyperthermophilic proteins like MJ1562, additional heat treatment steps can sometimes be employed to remove host cell proteins, taking advantage of the thermostability of archaeal proteins while ensuring the recombinant protein retains its native conformation.

How can researchers assess the membrane localization of MJ1562?

Confirming the membrane localization of MJ1562 is crucial for functional studies. Several complementary approaches can be employed:

  • Subcellular fractionation followed by Western blot analysis to detect the protein in membrane fractions

  • Fluorescence microscopy using GFP-tagged constructs to visualize cellular localization (though this requires careful design to not disrupt protein folding or targeting)

  • Protease protection assays to determine membrane topology

  • Immunogold electron microscopy for high-resolution localization studies

  • Computational prediction tools that analyze transmembrane domains (e.g., TMHMM, Phobius)

The protein's GO annotation (GO:0016020) indicates membrane localization , which should be experimentally verified in both native and recombinant expression systems to ensure proper folding and insertion.

What techniques can be used to study potential transport functions of MJ1562?

Based on its structural similarity to multidrug efflux transporters , MJ1562 may function in substrate transport. Researchers can employ several approaches to characterize this function:

  • Liposome reconstitution assays with purified protein to measure transport of labeled substrates

  • Electrophysiological methods such as patch-clamp or planar lipid bilayer recordings

  • Whole-cell transport assays using radioisotope-labeled or fluorescent substrates

  • Growth complementation studies in transport-deficient strains

  • Binding assays with potential substrates using techniques like isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)

For thermophilic membrane proteins, special consideration must be given to the temperature and lipid composition of assay systems to maintain native protein conformation and function. Researchers might consider developing biomimetic sensors similar to those described for other membrane receptors , which could help characterize MJ1562's binding and transport properties under controlled conditions.

How can researchers study MJ1562 in its native host M. jannaschii?

Studying MJ1562 in its native context presents significant challenges due to the extreme growth conditions required by M. jannaschii. A methodological approach would include:

  • Culturing M. jannaschii in specialized media at 80°C with H₂ and CO₂ mixture (80:20, v/v) under strictly anaerobic conditions

  • Utilizing genetic systems developed for M. jannaschii for gene deletion, modification, or reporter gene fusion

  • Isolating native membranes for biochemical and biophysical analyses

  • Employing transcriptomic and proteomic approaches to analyze expression patterns under different growth conditions

  • Developing targeted antibodies against MJ1562 for immunodetection studies

The growth protocol requires specialized equipment:

  • Sealed serum bottles containing anaerobic medium pressurized with H₂/CO₂ mixture

  • Incubation at 80°C with shaking (200 rpm)

  • For solid media, Gelrite®-based formulations prepared in an anaerobic chamber with precise addition of components such as MgCl₂, CaCl₂, Na₂S, cysteine, and yeast extract

How can structural biology techniques be applied to study MJ1562?

Understanding the three-dimensional structure of MJ1562 would provide critical insights into its function. Advanced structural biology approaches include:

  • X-ray crystallography, which requires:

    • Large-scale protein purification in detergent or lipidic environments

    • Crystallization screening optimized for membrane proteins

    • Synchrotron radiation for data collection

  • Cryo-electron microscopy (cryo-EM):

    • Sample preparation in various membrane mimetics (nanodiscs, amphipols)

    • High-resolution image acquisition and processing

    • Potential for capturing different conformational states

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Isotopic labeling (¹³C, ¹⁵N) of the protein

    • Selection of appropriate membrane mimetics

    • Assignment of resonances and structure calculation

  • Molecular dynamics simulations:

    • Building models based on homologous structures

    • Simulating protein behavior in lipid bilayers

    • Predicting substrate binding sites and conformational changes

The thermostable nature of MJ1562 may actually be advantageous for structural studies, as it might enhance protein stability during purification and crystallization attempts.

How should researchers address contradictions in functional data for MJ1562?

When investigating novel proteins like MJ1562, researchers often encounter conflicting experimental results. A systematic approach to resolving these contradictions includes:

  • Establishing standardized experimental conditions that account for the thermophilic nature of the protein

  • Implementing contradiction detection methodologies similar to those used in other fields to identify inconsistencies in research data

  • Conducting comparative analyses across different expression systems (e.g., E. coli vs. archaeal hosts)

  • Performing detailed domain-function mapping to determine if specific protein regions yield consistent or contradictory results

  • Utilizing appropriate statistical analysis to evaluate the significance of contradictory findings

When analyzing contradictory data, researchers should consider organism-specific factors that might affect protein function, such as membrane composition differences between archaea and bacteria, or the effect of temperature on protein conformation and activity.

What bioinformatic approaches are most effective for predicting MJ1562 function?

Given the limited experimental data on MJ1562, computational approaches are valuable for generating functional hypotheses:

  • Comparative genomic analysis across different archaeal species to identify conserved genomic contexts

  • Protein-protein interaction network prediction using tools like STRING-db

  • Evolutionary analysis to identify conserved residues that may be functionally important

  • Machine learning approaches trained on known membrane transporters to predict substrate specificity

  • Molecular docking simulations to evaluate potential binding partners or substrates

When applying these methods, researchers should be aware of potential limitations when using algorithms trained primarily on bacterial or eukaryotic proteins, as archaeal proteins may have unique features not well-represented in existing databases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.