Recombinant Methanocaldococcus jannaschii Putative metal transport protein MJ1569 (MJ1569)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, and customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
MJ1569; Putative metal transport protein MJ1569
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1569
Target Protein Sequence
MHIPDGYLGPITCAFFYLIMIPIWYKSIKELKKLDPRKLPLLGVLTAFSFLVMMFNLPVP DGTTAHMVGGTLIAILMDNPWVATIAISIVLIIQAIFFGDGGITCIGANCFNMGVVLPFV GYYVYKFLRDKVGEVIASGIGAYVGIVAAAIVAGFEFGLQPFIEPGYCPYPFTVSVPAMA FAHLITAGPAAAVVTAIVVWYVKKVRPDLFTSKEQQVSGVNA
Uniprot No.

Target Background

Function
This protein may be involved in metal transport.
Database Links

KEGG: mja:MJ_1569

STRING: 243232.MJ_1569

Protein Families
CbiM family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying metal transport proteins?

Methanocaldococcus jannaschii is a phylogenetically deeply rooted hyperthermophilic methanarchaeon with significant evolutionary and biochemical importance. It grows optimally at high temperatures with a remarkably short doubling time of only 26 minutes, making it considerably faster than other related organisms such as Methanosarcina acetivorans (8.5 hours) or Methanobrevibacter maripaludis (2 hours) . This archaeon is particularly valuable for studying metal transport mechanisms because:

  • It represents an ancient evolutionary lineage, providing insights into primitive metal transport systems

  • It thrives in extreme environments, suggesting specialized metal acquisition strategies

  • Its proteins often exhibit extraordinary thermostability, making them valuable for structural studies

  • Its genome has been fully sequenced, facilitating genetic manipulation and protein characterization

M. jannaschii has become an increasingly tractable experimental system since the development of genetic tools for its manipulation, including transformation protocols that require heat shock rather than chemical treatments like polyethylene glycol or liposomes used for other methanogens . This genetic accessibility allows for the creation of modified strains that can overexpress proteins of interest, including metal transporters like MJ1569.

How does MJ1569 relate to better-characterized metal transport protein families?

MJ1569 shares significant structural and functional similarities with the Nramp (Natural resistance-associated macrophage protein) family of transporters, which are expressed in organisms ranging from bacteria to humans. These membrane proteins enable the uptake of essential divalent transition metals through an alternating-access mechanism that typically involves proton co-transport .

Based on sequence analysis and structural predictions, MJ1569 likely adopts the LeuT fold characteristic of Nramp transporters. This fold consists of ten transmembrane helices arranged in a pseudo-symmetrical fashion, with important conformational changes occurring during the transport cycle. The functional significance of this architectural arrangement includes:

  • Formation of a central binding site for divalent metal ions

  • Coordination of metal ions by conserved residues from multiple transmembrane segments

  • Ability to undergo conformational changes between outward-open, occluded, and inward-open states

  • Distinct pathways for metal and proton transport that may converge at the binding site

While MJ1569 remains less characterized than homologs from other organisms, its study provides a unique opportunity to understand how metal transport mechanisms function under extreme thermophilic conditions .

What expression systems are suitable for producing recombinant MJ1569?

Expressing functional MJ1569 presents significant challenges due to the hyperthermophilic nature of its source organism. The table below compares different expression approaches with their relative advantages and limitations:

Expression SystemAdvantagesLimitationsTypical Yield
Homologous expression in M. jannaschiiNative folding environment, authentic post-translational modificationsTechnically challenging, requires specialized equipment for growth at high temperatures0.2-0.3 mg/L culture
E. coli with codon optimizationWell-established protocols, high yield potentialPotential misfolding, inclusion body formation, lack of thermophilic chaperonesVariable, often requires refolding
Thermophilic expression hosts (e.g., Thermus thermophilus)Better compatibility with thermostable proteinsLess developed genetic tools compared to E. coliModerate yields
Cell-free systems with thermophilic componentsAvoids toxicity issues, rapid productionHigher cost, potential scaling limitationsTypically sub-mg quantities

For homologous expression in M. jannaschii, the development of specialized vectors has been critical. These genetic tools must include:

  • Thermostable selectable markers (such as mevinolin resistance)

  • Origins of replication functional at high temperatures

  • Strong promoters active in M. jannaschii

  • Affinity tags compatible with hyperthermophilic proteins

Similar to the approach demonstrated with other M. jannaschii proteins, successful expression of MJ1569 would likely involve creating a suicide plasmid containing upstream and coding regions of the target gene to allow double cross-over homologous recombination with the chromosome . This strategy allows for controlled expression and the addition of affinity tags for purification.

What purification strategies are most effective for recombinant MJ1569?

Purifying recombinant MJ1569 requires careful consideration of its thermophilic nature and membrane protein characteristics. Based on successful approaches with related proteins, the following methodological workflow is recommended:

  • Membrane preparation: Harvest cells and disrupt by sonication or high-pressure homogenization in a buffer containing protease inhibitors. Collect membranes by ultracentrifugation.

  • Solubilization: Extract MJ1569 from membranes using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or other detergents stable at elevated temperatures.

  • Affinity chromatography: If expressed with an affinity tag (similar to the 3xFLAG-twin Strep tag approach used for other M. jannaschii proteins), purify using the corresponding affinity resin. For Strep-tagged constructs, use Streptactin XT superflow columns with biotin elution (10 mM D-biotin) .

  • Size exclusion chromatography: Further purify by gel filtration to separate aggregates and obtain homogeneous protein preparations.

  • Quality control: Verify purity by SDS-PAGE, Western blotting, and mass spectrometry to confirm protein identity and integrity.

When working with a Strep-tagged version of MJ1569, researchers might expect yields comparable to those observed with other M. jannaschii membrane proteins (approximately 0.26 mg purified protein per liter of culture) . The stability of the purified protein can be enhanced by maintaining it in appropriate detergent micelles or reconstituting it into lipid nanodiscs or proteoliposomes for functional studies.

How can genetic systems for M. jannaschii be optimized to achieve higher yields of recombinant MJ1569?

Developing an optimized genetic system for the overexpression of MJ1569 in M. jannaschii requires strategic engineering of several genetic elements. Based on successful approaches with other M. jannaschii proteins, the following methodological strategies should be considered:

  • Promoter optimization: Engineer stronger versions of native promoters or create synthetic hybrid promoters. For example, an engineered version of the P* promoter has been successfully used to drive high-level expression of other proteins in M. jannaschii . Comparative analysis of different promoter strengths should be conducted to identify optimal expression conditions.

  • Ribosome binding site (RBS) engineering: Optimize the translation initiation region to enhance protein synthesis. This includes:

    • Adjusting the spacing between the RBS and start codon

    • Optimizing the Shine-Dalgarno sequence for efficient ribosome recruitment

    • Eliminating secondary structures that might interfere with translation initiation

  • Codon optimization: While expressing in the native host, selective codon optimization can still be beneficial by focusing on highly expressed genes in M. jannaschii as reference.

  • Genetic construct design: For chromosomal integration and expression, design linear suicide vectors with:

    • Homology arms of appropriate length (typically 500-1000 bp) for efficient recombination

    • Selectable markers that function at high temperatures (e.g., mevinolin resistance)

    • Affinity tags optimized for hyperthermophilic proteins

  • Transformation protocol refinement: Optimize the heat shock transformation protocol specific to M. jannaschii, which differs from transformation methods used for other methanogens:

ParameterStandard ConditionOptimization RangeNotes
DNA concentration1-2 μg0.5-5 μgLinear DNA preferred over circular
Heat shock duration60 minutes30-90 minutesCritical for transformation efficiency
Recovery mediumStandard mediumSupplemented with additional carbon sourcesEnhances recovery after transformation
Selection pressureStandard mevinolin concentrationGradual increase in antibioticBalances selection stringency with cell viability

The implementation of these optimized genetic tools should lead to significantly improved yields of recombinant MJ1569 compared to heterologous expression systems, while ensuring proper folding and functionality of this thermophilic membrane protein .

What are the most effective experimental designs for studying MJ1569 conformational states?

Investigating conformational changes in MJ1569 during the transport cycle requires sophisticated experimental approaches that capture different states of the protein. Drawing from successful studies of related Nramp transporters, the following experimental design strategy is recommended:

  • Generation of conformation-specific mutants: Create a panel of MJ1569 variants designed to stabilize specific conformational states:

    • Outward-locked mutants: Introduce bulky tryptophan residues in the predicted external vestibule between transmembrane helices (similar to the G223W approach used with DraNramp)

    • Inward-locked mutants: Introduce mutations that prevent the opening of the extracellular vestibule (analogous to the G45R mutation in DraNramp that mimics a human anemia-causing mutation)

    • Occluded-state mutants: Design mutations that trap the protein in intermediate conformations

  • Structural analysis workflow:

    a. Crystallization screening: Test various detergents, lipids, and crystallization conditions optimized for thermophilic membrane proteins

    b. Structure determination methods:

    • X-ray crystallography for high-resolution static structures

    • Cryo-EM for capturing multiple conformational states

    • NMR for dynamic analyses of specific protein regions

    c. Validation of structural models using:

    • Molecular dynamics simulations

    • Cross-linking studies

    • EPR spectroscopy with site-directed spin labeling

  • Functional correlation with structural states:

    a. Transport assays using radioisotope-labeled metals or fluorescent metal indicators

    b. Accessibility studies using cysteine-scanning mutagenesis to map conformational changes

    c. Electrophysiological measurements to assess ion conductance properties

The following table summarizes the experimental approaches to capture specific conformational states:

Conformational StateMutagenesis StrategyValidation MethodExpected Functional Outcome
Outward-openTryptophan introduction in external vestibuleAccessibility studies, structural determinationImpaired metal transport but possible proton transport
Inward-openMutations preventing extracellular vestibule openingAccessibility studies, structural determinationAbolished metal and proton transport
OccludedMutations at hinge regions between domainsCross-linking, EPR spectroscopyTrapped intermediates with no transport activity

By combining these approaches, researchers can develop a comprehensive model of the conformational changes that MJ1569 undergoes during the transport cycle, similar to what has been achieved for other members of the Nramp family .

How does the metal binding mechanism of MJ1569 compare to other metal transporters?

Understanding the metal binding and transport mechanism of MJ1569 requires comparative analysis with well-characterized metal transporters. Based on studies of related Nramp family transporters, the following methodological approach can elucidate MJ1569's unique properties:

  • Metal binding site characterization:

    a. Site-directed mutagenesis of predicted metal-coordinating residues

    b. Metal affinity measurements using:

    • Isothermal titration calorimetry (ITC)

    • Microscale thermophoresis (MST)

    • Equilibrium dialysis with radioisotope-labeled metals

    c. Spectroscopic analysis of metal binding:

    • X-ray absorption spectroscopy (XAS) to determine coordination geometry

    • Electron paramagnetic resonance (EPR) for paramagnetic metals

    • Förster resonance energy transfer (FRET) with fluorescently labeled protein

  • Metal selectivity profile:

    a. Competition assays with various transition metals

    b. Transport kinetics measurements for different metals

    c. Structural determinants of selectivity identified through mutagenesis

  • Proton coupling mechanism:

    a. pH-dependence of metal binding and transport

    b. Identification of proton-binding residues

    c. Assessment of proton transport independent of metal transport

The table below compares the predicted characteristics of MJ1569 with other well-studied metal transporters:

CharacteristicMJ1569 (predicted)DraNrampHuman DMT1Bacterial ZIP
Metal selectivityDivalent transition metalsMn²⁺, Fe²⁺, Co²⁺, Ni²⁺Fe²⁺, Mn²⁺, Cd²⁺, Co²⁺Zn²⁺, Fe²⁺
Proton couplingLikely co-transportProton co-transportProton co-transportVariable
Temperature optimum85-95°C65-70°C37°C20-37°C
Key binding residuesConserved acidic and polarD56, N59, M230, etc.D86, N89, M265, etc.Histidine-rich
Transport rateUnknown, potentially high2,100 μmol/min/mg for FprA 5-20 nmol/min/mgVariable

Based on studies of DraNramp, it appears that while metal transport requires cycling between outward-open and inward-open states, proton transport can still occur efficiently in the outward-locked conformations . This suggests separate pathways for metal and proton transport through the protein. For MJ1569, determining whether this mechanistic separation also exists would be a significant finding with implications for understanding the evolution of ion-coupled transport mechanisms.

What specialized assay conditions are required for measuring MJ1569 transport activity?

Measuring the transport activity of a hyperthermophilic membrane protein like MJ1569 presents unique challenges that require carefully designed assay conditions. The following methodological approach is recommended:

  • Preparation of functional protein:

    a. Reconstitution methods:

    • Proteoliposomes: Reconstitute purified MJ1569 into liposomes composed of thermostable lipids

    • Nanodiscs: Incorporate protein into nanodiscs using thermostable scaffold proteins

    • Planar lipid bilayers: For electrophysiological measurements

    b. Orientation control:

    • Establish methods to determine protein orientation in reconstituted systems

    • Create asymmetric conditions across the membrane

  • Transport assay design for hyperthermophilic conditions:

    a. Temperature considerations:

    • Conduct assays at physiologically relevant temperatures (85-95°C)

    • Use specialized equipment designed for high-temperature measurements

    • Implement temperature control systems with minimal gradient formation

    b. Buffer stability:

    • Select buffers with minimal pH shift at high temperatures

    • Use thermostable pH indicators for real-time monitoring

    • Account for increased rates of spontaneous metal oxidation at high temperatures

  • Metal transport measurement techniques:

    a. Radioisotope uptake assays:

    • ⁵⁵Fe, ⁵⁴Mn, ⁶⁰Co, or other relevant radioisotopes

    • Rapid filtration or centrifugation to separate vesicles

    • Scintillation counting for quantification

    b. Fluorescence-based methods:

    • Metal-sensitive fluorophores (ensuring thermostability)

    • Stopped-flow spectroscopy for rapid kinetics

    • Fluorescence quenching assays

  • Proton transport assays:

    a. pH-sensitive fluorophores:

    • Thermostable pH indicators (e.g., modified BCECF)

    • Ratiometric measurements to control for temperature effects

    b. Measurement of proton fluxes:

    • pH electrode-based methods adapted for high temperatures

    • Proton gradient dissipation kinetics

The table below provides a comparison of different assay conditions and their suitability for MJ1569:

Assay ParameterStandard ConditionsOptimized for MJ1569Technical Considerations
Temperature20-37°C85-95°CSpecialized equipment required; increased background rates
pH6.5-7.56.0-7.0Account for increased neutral pH at high temperatures
Metal concentration1-100 μM10-50 μMHigher concentrations may be needed due to decreased affinity
Time resolutionSeconds to minutesMilliseconds to secondsExpect faster kinetics at high temperatures
Detection methodVariousThermostable fluorophores, radioisotopesEnsure detector components are thermally isolated

By following these methodological guidelines, researchers can develop reliable assays for measuring MJ1569 transport activity under conditions that approximate its native environment. Similar approaches have been successful with other thermophilic transporters, yielding valuable kinetic and mechanistic insights .

How can site-directed mutagenesis be used to investigate the structure-function relationship of MJ1569?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationship of MJ1569. Building on successful mutagenesis strategies applied to related Nramp transporters, the following systematic methodology is recommended:

  • Identification of target residues:

    a. Sequence conservation analysis:

    • Align MJ1569 with characterized metal transporters

    • Identify absolutely conserved residues across diverse species

    • Note thermophile-specific sequence adaptations

    b. Structural prediction-guided selection:

    • Metal-coordinating residues in binding site

    • Residues in proposed proton transport pathway

    • Residues at domain interfaces involved in conformational changes

    • Thermostability-conferring residues unique to extremophiles

  • Mutagenesis strategy design:

    a. Mutation types:

    • Conservative substitutions to preserve general chemistry

    • Charge-altering mutations to test electrostatic interactions

    • Introduction of bulky side chains to probe steric requirements

    • Cysteine substitutions for accessibility studies and cross-linking

    b. Experimental grouping of mutations:

    • Metal binding site mutations

    • Proton pathway mutations

    • Conformational hinge mutations

    • Thermostability-related mutations

  • Functional characterization of mutants:

    a. Expression and stability assessment:

    • Quantification of expression levels

    • Thermal stability measurements

    • Detergent stability analysis

    b. Metal binding properties:

    • Binding affinity determination

    • Metal selectivity profile changes

    • Coordination geometry alterations

    c. Transport activity:

    • Metal transport kinetics

    • Proton coupling efficiency

    • Temperature dependence of activity

The following table outlines a strategic mutagenesis approach targeting different functional aspects of MJ1569:

Functional DomainPotential Target ResiduesMutation StrategyExpected OutcomeAnalytical Method
Metal binding siteConserved D, N, M residues (based on DraNramp D56, N59, M230) D→N, D→A, N→D, M→LAltered metal selectivity and affinityITC, transport assays
Proton pathwayConserved E, H residuesE→Q, E→A, H→A, H→RDisrupted proton couplingpH-dependent transport assays
External gateResidues at extracellular vestibuleIntroduction of W (similar to G223W in DraNramp) Outward-locked conformationAccessibility studies
Internal gateResidues at intracellular vestibuleG→R (similar to G45R in DraNramp) Inward-locked conformationAccessibility studies
Thermostability elementsThermophile-specific residuesSubstitution with mesophilic equivalentsReduced thermostabilityThermal denaturation assays

By implementing this comprehensive mutagenesis approach, researchers can develop a detailed mechanistic model of MJ1569 function and identify the structural features that enable this protein to function efficiently in extreme thermophilic conditions. This approach parallels successful studies with DraNramp that revealed separate pathways for metal and proton transport and elucidated key conformational changes during the transport cycle .

What control experiments are essential when working with recombinant MJ1569?

Rigorous control experiments are critical for ensuring the validity and reproducibility of research on recombinant MJ1569. The following methodological framework outlines essential controls for various experimental aspects:

  • Expression and purification controls:

    a. Negative controls:

    • Empty vector transformants processed identically to MJ1569-expressing strains

    • Non-induced samples when using inducible expression systems

    b. Positive controls:

    • Well-characterized protein expressed using the same system

    • Commercial protein standards for quantification

    c. Quality control:

    • Mass spectrometry verification of protein identity (should identify at least 50% of the primary structure)

    • Western blot analysis using tag-specific antibodies

    • N-terminal sequencing to confirm correct processing

  • Functional assay controls:

    a. Transport activity:

    • Empty liposomes/nanodiscs without protein

    • Heat-inactivated protein samples

    • Known inhibitors of metal transport

    • Ionophores to establish maximum transport rates

    b. Metal binding:

    • Non-specific binding to experimental apparatus

    • Competition with known metal chelators

    • Background signal correction

  • Specificity controls:

    a. Substrate selectivity:

    • Non-transported metal ions

    • Transport in the absence of coupling ions (H⁺)

    • Transport under varying pH conditions

    b. Inhibitor specificity:

    • Dose-response relationships

    • Structurally related non-inhibitory compounds

  • Technical controls:

    a. Temperature stability:

    • Monitoring of temperature throughout high-temperature assays

    • Assessment of spontaneous leakage/degradation at experimental temperatures

    b. Buffer composition:

    • Effects of different buffer systems on activity

    • Control for metal contamination in buffers

The table below summarizes critical control experiments for key assays:

Experimental AspectCritical ControlPurposeImplementation
Protein expressionEmpty vectorDistinguish target protein from backgroundProcess in parallel with experimental samples
Protein purityMass spectrometryConfirm identity and integrityShould identify >50% of sequence including tags
Metal transportIonophore treatmentEstablish maximum transport capacityAdd ionophore after steady state to determine total loading capacity
Binding specificityCompetitive bindingDistinguish specific from non-specific bindingPre-incubate with non-labeled metals before adding labeled substrate
Temperature effectsGradient controlsAccount for temperature-dependent artifactsInclude temperature monitoring probes in different positions
Proton couplingpH gradient dissipationVerify H⁺ requirementCompare transport rates with and without pH gradient

Implementation of these control experiments will ensure that observations attributed to MJ1569 function are specific and reproducible, addressing the inherent challenges of working with a hyperthermophilic membrane protein in artificial experimental systems.

How should researchers design experiments to address potential artifacts in MJ1569 studies?

Working with a hyperthermophilic membrane protein presents unique challenges that can introduce artifacts into experimental results. The following methodological framework addresses potential sources of artifacts and provides strategies to mitigate them:

  • Thermostability artifacts:

    a. Potential issues:

    • Protein denaturation during temperature transitions

    • Aggregation at sub-optimal temperatures

    • Partial unfolding causing non-native activity

    b. Mitigation strategies:

    • Implement gradual temperature ramping protocols

    • Include thermostability additives (e.g., glycerol, specific ions)

    • Monitor protein state with thermal shift assays

    • Design temperature-controlled experimental apparatus

  • Lipid environment artifacts:

    a. Potential issues:

    • Lipid composition effects on protein function

    • Phase transitions at experimental temperatures

    • Oxidation of lipids at high temperatures

    b. Mitigation strategies:

    • Use archaeal lipids or synthetic thermostable lipids

    • Test multiple reconstitution conditions

    • Implement antioxidant strategies

    • Characterize lipid phase behavior at experimental temperatures

  • Metal chemistry artifacts:

    a. Potential issues:

    • Altered metal solubility at high temperatures

    • Increased oxidation rates of reduced metals

    • Changed coordination chemistry at extreme temperatures

    b. Mitigation strategies:

    • Include appropriate redox control agents

    • Account for temperature-dependent solubility changes

    • Use oxygen-scavenging systems when appropriate

    • Implement rapid mixing techniques to minimize exposure time

  • Experimental design strategies:

    a. Parallel condition testing:

    • Conduct identical experiments at multiple temperatures

    • Compare results from different expression/reconstitution systems

    b. Statistical approaches:

    • Implement factorial experimental designs

    • Use appropriate statistical tests for temperature-dependent data

    • Conduct power analyses to determine sample size requirements

The following experimental designs address specific artifacts in MJ1569 research:

Artifact SourceExperimental DesignControlsData Analysis Approach
Temperature-dependent protein stabilityThermal stability gradientPre-incubated vs. fresh protein samplesFirst-derivative analysis of stability curves
Lipid phase transitionsDifferential scanning calorimetry of proteoliposomesProtein-free liposomesDeconvolution of protein and lipid transitions
Metal oxidationOxygen-controlled transport assaysParallel experiments with oxidized metalsKinetic modeling with oxidation rate constants
Expression system effectsParallel characterization from multiple sourcesIdentical purification strategiesNormalization to specific activity
Detergent interferenceSystematic screening of detergent types/concentrationsDetergent exchange controlsActivity recovery analysis

By implementing these experimental designs and control strategies, researchers can distinguish genuine MJ1569 properties from artifacts introduced by the experimental conditions required to study this hyperthermophilic transporter. This approach follows established principles for rigorous experimental design in challenging biological systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.