Recombinant Methanocaldococcus jannaschii Putative zinc metalloprotease MJ0611 (MJ0611)

Shipped with Ice Packs
In Stock

Description

Production and Handling

MJ0611 is produced via heterologous expression in E. coli . Critical handling parameters include:

ParameterSpecificationSource
Expression HostE. coli
Purification TagN-terminal His tag
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (long-term), 4°C (short-term working aliquots)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol (recommended)

Repeated freeze-thaw cycles are discouraged to preserve enzymatic activity .

Functional Insights

While MJ0611 is annotated as a zinc metalloprotease, its specific enzymatic activity remains uncharacterized. Key inferences include:

  • Zinc Dependency: Like other metalloproteases, MJ0611 likely requires zinc for catalysis, coordinated via conserved residues (e.g., histidine, aspartate) .

  • M50B Family Role: The M50B family includes enzymes involved in membrane protein processing (e.g., SREBP cleavage). MJ0611 may participate in analogous archaeal pathways, though experimental validation is lacking .

  • Autoprocessing Potential: Some metalloproteases undergo autoprocessing (e.g., thermolysin-like proteases), but no evidence exists for MJ0611 .

Research Applications

MJ0611 serves as a model system for studying metalloprotease structure-function relationships:

ApplicationDetailsSource
Structural BiologyCrystallography and NMR studies to elucidate zinc-binding motifs and active site geometry
Enzymatic AssaysTesting hydrolytic activity against synthetic substrates (e.g., collagen, casein)
Comparative StudiesPhylogenetic analysis with homologs in other archaea or bacteria

Limitations and Future Directions

  • Functional Gaps: No experimental data confirm MJ0611’s substrate specificity or catalytic activity.

  • Expression Challenges: E. coli may not replicate archaeal post-translational modifications, potentially affecting activity.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If you require a specific tag type, please inform us, and we will prioritize its implementation.
Synonyms
MJ0611; Putative zinc metalloprotease MJ0611
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0611
Target Protein Sequence
MSIFRFSQREIIDLTISVLAIAFIFSYPNFSILVFIISLIAVGSGFIFHELMHRTVARKY GAWSEFRAWYEGLILGFILKLVFGATFIAPGAVYIYKDYLTPEENGKIALAGPLTNVALA FVFFILMLIFKPGSLLYWIGIFGFHINLFLAGFNMLPIPPFDGEKVLKWNPFIWAIVGLP LIGYMLYMMFW
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0611

STRING: 243232.MJ_0611

Protein Families
Peptidase M50B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying MJ0611?

Methanocaldococcus jannaschii is a thermophilic methanogenic archaean in the class Methanococci. It holds historical significance as the first archaeon to have its complete genome sequenced, providing strong evidence for the three-domain classification of life . M. jannaschii was isolated from submarine hydrothermal vents at the East Pacific Rise at a depth of 2600m, where it thrives in extreme conditions (temperatures of 48-94°C) .

The significance of studying MJ0611 within this organism stems from several factors:

  • As a thermophilic archaeon, M. jannaschii possesses uniquely adapted proteins that function under extreme conditions.

  • The genome sequencing revealed many archaeal-specific genes and metabolic pathways .

  • Zinc metalloproteases from extremophiles like M. jannaschii often exhibit exceptional stability and unique catalytic properties.

  • Understanding MJ0611 contributes to our knowledge of archaeal protein function and evolution.

Table 1. Key Properties of Methanocaldococcus jannaschii

PropertyDescriptionRelevance to MJ0611 Research
Genome Size1.66 Mbp circular chromosome (G+C content: 31.4%) Genomic context affects understanding of MJ0611 function
Growth Temperature48-94°C (optimal: ~85°C)Influences protein thermostability and assay design
MetabolismMethanogenic (CO₂ + H₂ → CH₄) Metabolic context for potential physiological roles
HabitatDeep-sea hydrothermal ventsAdaptations to high pressure and temperature
PhylogenyDomain: Archaea; Class: Methanococci Evolutionary context for comparative studies
Unique FeatureFirst archaeon with sequenced genome Well-characterized genetic background

What experimental approaches are recommended for initial characterization of MJ0611?

Initial characterization of MJ0611 should follow a systematic approach that addresses both sequence-based predictions and empirical biochemical properties:

  • Sequence analysis:

    • Identify conserved zinc-binding motifs (typically HEXXH in metalloproteases)

    • Conduct multiple sequence alignment with characterized metalloproteases

    • Perform domain architecture analysis and secondary structure prediction

    • Use homology modeling to predict three-dimensional structure

  • Recombinant expression optimization:

    • Design synthetic gene with codon optimization for the expression host

    • Test multiple expression systems (E. coli, yeast, insect cells)

    • Evaluate different fusion tags (His, MBP, SUMO) for improved solubility

    • Optimize induction conditions considering the thermophilic nature of the protein

  • Purification strategy development:

    • Implement multi-step chromatography (affinity, ion exchange, size exclusion)

    • Test buffer conditions with various stabilizing additives

    • Verify protein purity by SDS-PAGE and mass spectrometry

    • Assess zinc content using atomic absorption spectroscopy or colorimetric assays

  • Basic biochemical characterization:

    • Determine temperature and pH optima for activity

    • Assess thermal stability using differential scanning fluorimetry

    • Evaluate metal ion dependency and specificity

    • Screen potential substrates to establish preliminary activity profile

This methodological approach provides a foundation for more detailed functional studies and ensures that subsequent experiments are conducted with properly characterized protein.

How should researchers interpret the "putative" designation of MJ0611 as a zinc metalloprotease?

The "putative" designation indicates that MJ0611's classification as a zinc metalloprotease is based on sequence homology and computational predictions rather than experimental verification. This designation has important implications for research design:

  • Verification requirements:

    • Experimental confirmation of zinc binding is essential, using techniques such as inductively coupled plasma mass spectrometry (ICP-MS) or atomic absorption spectroscopy

    • Demonstration of proteolytic activity with specific substrates is necessary

    • Confirmation that activity depends on zinc and is inhibited by metal chelators like EDTA

  • Alternative function considerations:

    • Some metalloproteases can function as isomerases, deacylases, or phosphatases

    • Substrate specificity may differ from predicted patterns

    • MJ0611 might possess multiple catalytic activities

  • Structural validation approaches:

    • X-ray crystallography or cryo-EM to confirm zinc coordination geometry

    • Site-directed mutagenesis of predicted catalytic residues

    • Binding studies with known metalloprotease inhibitors

  • Evolutionary context assessment:

    • Comparison with experimentally validated metalloproteases in related archaea

    • Analysis of gene neighborhood for functional hints

    • Consideration of potential horizontal gene transfer events

When working with putative enzymes, researchers should design experiments that not only test the predicted function but also can identify alternative activities, thereby avoiding confirmation bias in experimental design.

How should researchers design expression systems for recombinant MJ0611?

Designing effective expression systems for archaeal proteins like MJ0611 presents unique challenges due to differences in protein folding machinery, codon usage, and post-translational modifications between archaea and typical expression hosts. An experimental research design must account for these factors .

Table 2. Comparison of Expression Systems for Thermophilic Archaeal Proteins

Expression SystemAdvantagesDisadvantagesRecommended Modifications for MJ0611
E. coli (standard)Easy to use, high yield, economicalProtein misfolding, inclusion bodiesLow temperature induction (15-25°C), co-expression with chaperones
E. coli Arctic ExpressEnhanced folding at low temperaturesLower expression yieldsSupplement with zinc in growth medium
Thermophilic bacteria (T. thermophilus)Natural thermophilic folding machineryLess established genetic toolsCodon optimization, strong inducible promoters
Archaeal hosts (S. solfataricus)Native-like folding environmentLower yields, technical challengesHomologous recombination for stable integration
Cell-free systemsRapid, avoids toxicity issuesCost, scale limitationsSupplementation with archaeal chaperones
Yeast (P. pastoris)Eukaryotic folding, secretionGlycosylation may differDeletion of potential glycosylation sites

Methodological considerations for optimal expression:

  • Vector design:

    • Include a strong, inducible promoter with tight regulation

    • Incorporate solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Design constructs with various N- and C-terminal truncations

    • Add purification tags that can be removed without affecting structure

  • Experimental conditions optimization:

    • Test multiple induction temperatures (15-37°C)

    • Vary inducer concentration and induction timing

    • Supplement growth media with zinc and other cofactors

    • Extend expression time for proper folding

  • Extraction and purification strategy:

    • Develop lysis buffers that maintain protein stability

    • Incorporate protease inhibitors to prevent degradation

    • Test both native and denaturing/refolding approaches

    • Include stabilizing agents in purification buffers

  • Quality control methods:

    • Assess zinc content per protein molecule

    • Verify correct folding using circular dichroism

    • Perform size exclusion chromatography to confirm monomeric state

    • Validate activity correlation with protein purity

This systematic approach follows principles of experimental research design by manipulating independent variables (expression conditions) while measuring dependent variables (protein yield, solubility, and activity) .

What are the optimal conditions for designing MJ0611 activity assays?

Designing robust activity assays for a putative zinc metalloprotease from a thermophilic archaeon requires careful consideration of temperature, buffer composition, and substrate selection. The experimental design must account for the enzyme's extremophilic origin .

Table 3. Recommended Conditions for MJ0611 Activity Assays

ParameterRange to TestRationaleControls
Temperature60-95°C in 5°C incrementsMatch native environment of M. jannaschiiInclude mesophilic metalloprotease at lower temperatures
pH5.0-9.0 in 0.5 incrementsDetermine pH optimumBuffer-only controls at each pH
BufferPIPES, HEPES, Tris, phosphate (50-100 mM)Test buffer compatibilityAccount for temperature effects on pKa
Zinc concentration0.01-1 mM ZnCl₂Optimize cofactor availabilityEDTA-treated negative control
Substrate concentration0.1-10× estimated KmEnsure linear kineticsSubstrate-only controls
Reducing agentsDTT, β-mercaptoethanol (0-10 mM)Test effect on disulfide bondsMonitor zinc precipitation
Salt concentration0-500 mM NaClOptimize ionic strengthAccount for halophilic adaptations

Methodological approach for activity assay development:

  • Substrate selection strategy:

    • Fluorogenic peptide substrates with AMC or MCA leaving groups

    • FRET-based peptide substrates for continuous monitoring

    • Generic protease substrates (casein, gelatin) for initial screening

    • Specific peptides based on sequence preferences of related metalloproteases

  • Detection method optimization:

    • Continuous fluorometric assays for kinetic parameters

    • Endpoint assays for high-throughput condition screening

    • SDS-PAGE analysis for protein substrate cleavage

    • Mass spectrometry to identify specific cleavage sites

  • Controls and validation:

    • Heat-inactivated enzyme controls

    • Metal chelation (EDTA, 1,10-phenanthroline) for specificity confirmation

    • Known metalloprotease inhibitors (phosphoramidon, bestatin)

    • Catalytic site mutants as negative controls

  • Data analysis approach:

    • Determine kinetic parameters using appropriate models

    • Construct temperature and pH profiles

    • Analyze substrate specificity patterns

    • Assess inhibition patterns and mechanisms

This structured experimental approach ensures reliable characterization of MJ0611 activity and follows sound principles of experimental research design .

How should researchers address the challenges of data contradiction in MJ0611 functional studies?

When investigating novel proteins like MJ0611, researchers may encounter contradictory results due to various factors including experimental conditions, protein preparation methods, or intrinsic properties of the enzyme. A systematic approach to resolving these contradictions is essential.

  • Systematic contradiction analysis:

    • Document all experimental conditions in detail

    • Verify protein quality across different preparations

    • Test for interfering contaminants in reagents

    • Validate assay detection methods with standards

  • Hypothesis-driven investigation:

    • Formulate testable hypotheses about sources of contradiction

    • Design controlled experiments to isolate variables

    • Perform side-by-side comparisons under identical conditions

    • Test multiple batches of protein and substrates

  • Statistical approach:

    • Apply appropriate statistical tests to determine significance

    • Perform power analysis to ensure adequate sample size

    • Use outlier detection methods appropriately

    • Consider Bayesian approaches for complex data sets

  • Consider biological explanations:

    • Multiple activity modes or conformational states

    • Allosteric regulation or substrate inhibition

    • Post-translational modifications or autoproteolysis

    • Temperature-dependent structural changes

  • Documentation and reporting:

    • Report contradictory findings transparently

    • Provide raw data and detailed methods

    • Discuss limitations and alternative interpretations

    • Suggest experimental approaches to resolve contradictions

This methodological framework follows the principles of experimental research design by systematically controlling variables and testing hypotheses . By methodically exploring the causes of contradictory results, researchers can not only resolve discrepancies but often discover new insights about the protein's function and regulation.

What sophisticated techniques can distinguish between specific and non-specific activities of MJ0611?

Distinguishing between specific enzymatic activities and non-specific or artifactual activities is crucial when characterizing novel enzymes like MJ0611. Advanced methodological approaches can provide conclusive evidence for specificity.

Table 4. Methods for Distinguishing Specific vs. Non-specific MJ0611 Activities

MethodApproachAdvantagesLimitations
Active Site MutagenesisMutation of predicted catalytic residuesDirect evidence for mechanismRequires structural knowledge
Metal SubstitutionReplace Zn²⁺ with Co²⁺ or Ni²⁺Maintains activity with spectral propertiesSome activity loss expected
Isothermal Titration CalorimetryMeasure binding thermodynamicsQuantitative binding parametersRequires stable protein
Proteomics-based Substrate IdentificationMS identification of cleaved proteinsDiscovers physiological substratesComplex data analysis
Activity-based Protein ProfilingUse active site-directed probesLabels only active enzymeProbe availability
Inhibitor Specificity ProfilingTest class-specific inhibitorsPharmacological classificationCross-reactivity issues
Pre-steady State KineticsMeasure rapid initial ratesReveals catalytic mechanismSpecialized equipment needed

Experimental design considerations for establishing specificity:

  • Comprehensive controls:

    • Catalytically inactive mutants (E→A, H→A mutations in HEXXH motif)

    • Metal-free apoenzyme preparations

    • Heat-denatured enzyme controls

    • Substrate specificity panels with systematic variations

  • Mechanistic investigations:

    • pH-rate profiles to identify catalytic residues

    • Solvent isotope effects to probe proton transfer

    • Temperature dependence to calculate activation parameters

    • Viscosity effects to assess diffusion limitations

  • Structural approaches:

    • Co-crystallization with inhibitors or substrate analogs

    • HDX-MS to identify substrate binding regions

    • Site-directed spin labeling for dynamics studies

    • Molecular dynamics simulations of substrate binding

  • Biophysical binding studies:

    • Surface plasmon resonance with immobilized substrate

    • Microscale thermophoresis for solution-based affinity

    • Fluorescence anisotropy for labeled substrate binding

    • Bio-layer interferometry for real-time binding analysis

By combining multiple approaches, researchers can build a compelling case for the specific activities of MJ0611 and distinguish them from non-specific or artifactual activities .

How can researchers integrate structural studies with functional analysis of MJ0611?

Integrating structural biology with functional studies provides comprehensive insights into enzyme mechanism, substrate specificity, and regulation. For MJ0611, this integrated approach is particularly valuable given its thermophilic origin and putative classification.

  • Structure-guided functional analysis:

    • Use homology models or experimental structures to identify catalytic residues

    • Design mutations based on structural features

    • Identify potential substrate binding pockets

    • Map conservation patterns onto structural elements

  • Structure-function correlation techniques:

    • Site-directed mutagenesis of predicted functional residues

    • Domain swapping with related metalloproteases

    • Truncation analysis guided by domain boundaries

    • Disulfide engineering to probe conformational states

  • Advanced structural methods:

    • X-ray crystallography at multiple pH values and with various ligands

    • Cryo-EM for conformational ensemble analysis

    • HDX-MS to identify dynamic regions and binding interfaces

    • Small-angle X-ray scattering for solution conformation

  • Computational approaches:

    • Molecular dynamics simulations at elevated temperatures

    • Molecular docking of potential substrates

    • Quantum mechanics/molecular mechanics for reaction mechanism

    • Normal mode analysis for functional motions

  • Integration strategy:

    • Iterative approach between structural insights and functional testing

    • Correlation of structural features with kinetic parameters

    • Development of structure-based activity assays

    • Use of structural information for rational enzyme engineering

This integrated approach allows researchers to develop a mechanistic understanding of MJ0611 that explains its substrate specificity, catalytic efficiency, and adaptations to extreme conditions.

What statistical methodologies are most appropriate for analyzing temperature effects on MJ0611 activity?

Given MJ0611's origin from a thermophilic organism, understanding temperature effects on its activity requires sophisticated statistical approaches that account for complex, non-linear relationships and multiple influencing factors.

  • Thermodynamic parameter estimation:

    • Arrhenius plots for activation energy calculation

    • Eyring equation analysis for enthalpy and entropy of activation

    • Statistical thermodynamics models for temperature dependence

    • Multi-parameter fitting for complex temperature responses

  • Experimental design considerations:

    • Full factorial designs to assess temperature interactions with other variables

    • Response surface methodology for optimizing multiple parameters

    • Blocked designs to control for batch effects

    • Time-course studies at multiple temperatures

  • Statistical analysis methods:

    • Non-linear regression for fitting thermodynamic models

    • ANOVA with temperature as categorical or continuous variable

    • Mixed-effects models for repeated measures

    • Bootstrap resampling for parameter confidence intervals

  • Advanced analytical approaches:

    • Bayesian inference to incorporate prior knowledge

    • Principal component analysis for multivariate data reduction

    • Cluster analysis for identifying temperature response patterns

    • Machine learning algorithms for complex pattern recognition

  • Data visualization techniques:

    • 3D surface plots of activity-temperature-pH relationships

    • Heat maps for substrate specificity across temperature range

    • Contour plots for identifying optimal conditions

    • Time-series animations for temperature stability studies

By applying appropriate statistical methods, researchers can extract meaningful insights about MJ0611's adaptation to high temperatures and optimize conditions for in vitro applications.

How can researchers use comparative genomics to understand MJ0611's evolutionary significance?

Comparative genomics provides crucial insights into the evolutionary history, functional conservation, and potential physiological roles of MJ0611. This approach places the protein in its broader biological context.

Table 5. Key Zinc Metalloproteases Across Three Domains of Life for Evolutionary Comparison

DomainRepresentative OrganismMetalloproteaseFunctionSimilarity to MJ0611
ArchaeaThermococcus kodakarensisTK0512Protein turnoverClose archaeal homolog
ArchaeaSulfolobus solfataricusSSO0519Peptide processingDistant archaeal relative
BacteriaThermus thermophilusTT1542Cell divisionThermophilic bacterial counterpart
BacteriaEscherichia coliPrc/TspCarboxy-terminal processingMesophilic bacterial homolog
EukaryaHomo sapiensNeprilysinNeuropeptide degradationDistant eukaryotic relative
EukaryaSaccharomyces cerevisiaeSte24pa-factor processingEukaryotic functional analog

Methodological approaches for comparative genomics:

  • Sequence-based analysis:

    • Identification of orthologs across archaeal species

    • Detection of paralogs within M. jannaschii genome

    • Multiple sequence alignment with structure-guided refinement

    • Molecular evolutionary analysis (dN/dS, selection pressure)

  • Genome context analysis:

    • Examination of gene neighborhood conservation

    • Operon structure prediction

    • Regulatory element identification

    • Co-occurrence patterns across genomes

  • Phylogenetic studies:

    • Maximum likelihood tree construction

    • Bayesian phylogenetic inference

    • Reconciliation with species phylogeny

    • Dating of gene duplication and horizontal transfer events

  • Functional inference:

    • Gene ontology enrichment analysis of genomic context

    • Protein-protein interaction network comparison

    • Metabolic pathway association across species

    • Phenotypic correlation with gene presence/absence

  • Experimental validation:

    • Heterologous expression of homologs

    • Functional complementation studies

    • Chimeric protein construction

    • Activity comparison across homologs

This comparative approach provides a framework for understanding MJ0611's evolutionary history, functional conservation, and potential roles in archaeal biology.

What approaches can reveal adaptations of MJ0611 to extreme environments?

As a protein from a thermophilic, barophilic archaeon, MJ0611 likely exhibits multiple adaptations for function in extreme environments. Revealing these adaptations requires specialized experimental and computational approaches.

  • Comparative stability analysis:

    • Thermal denaturation studies across homologs from different thermal niches

    • Pressure stability comparison between MJ0611 and mesophilic counterparts

    • Chemical denaturation resistance profiling

    • Long-term stability assessment under various conditions

  • Structural adaptation identification:

    • Analysis of charged residue distribution and ion pair networks

    • Hydrophobic core composition comparison

    • Disulfide bond and metal binding site evaluation

    • Comparison of loop flexibility and secondary structure content

  • Activity-stability relationship studies:

    • Temperature-activity profiles for MJ0611 vs. mesophilic homologs

    • Evaluation of catalytic efficiency vs. stability trade-offs

    • Pressure effects on catalytic parameters

    • Activity retention after extreme condition exposure

  • Molecular dynamics approaches:

    • Simulations at elevated temperatures and pressures

    • Root mean square fluctuation analysis

    • Essential dynamics to identify stabilizing motions

    • Free energy calculations for stability determinants

  • Engineering and validation:

    • Site-directed mutagenesis of potential stabilizing features

    • Transfer of stability elements to mesophilic homologs

    • Directed evolution under extreme conditions

    • Rational design of hyperstable variants

By systematically investigating these adaptations, researchers can develop principles of protein stability under extreme conditions and potentially apply these insights to engineer enzymes for biotechnological applications.

How can researchers investigate the potential physiological roles of MJ0611 in M. jannaschii?

Understanding the physiological function of MJ0611 in its native context is challenging but essential for comprehensive characterization. Several complementary approaches can help elucidate its biological role.

  • Substrate identification strategies:

    • Proteomics-based identification of native substrates

    • Metabolomics profiling under various growth conditions

    • Bioinformatic prediction of potential substrates

    • In vitro screening with cell extract fractions

  • Expression pattern analysis:

    • Transcriptomics under different growth conditions

    • Proteomics to confirm protein expression levels

    • Reporter gene fusions to monitor expression

    • Response to environmental stressors

  • Genetic approaches:

    • Gene knockout or knockdown (if genetic systems available)

    • Overexpression and phenotype analysis

    • Complementation studies with heterologous systems

    • CRISPR interference in related archaea with established genetic tools

  • Localization and interaction studies:

    • Subcellular fractionation and localization

    • Co-immunoprecipitation to identify interaction partners

    • Protein-protein interaction prediction

    • Structural modeling of potential interaction interfaces

  • Evolutionary and environmental contextualization:

    • Correlation of gene presence with ecological niches

    • Comparison of function across closely related species

    • Analysis of co-evolved gene clusters

    • Metabolic modeling to predict pathway involvement

This multi-faceted approach can provide converging evidence for MJ0611's physiological role despite the challenges of working with extremophilic archaea.

What are the most promising strategies for engineering MJ0611 for biotechnological applications?

The thermostability and potential unique specificity of MJ0611 make it an attractive candidate for protein engineering aimed at biotechnological applications. Several methodological approaches can guide such engineering efforts.

  • Rational design strategies:

    • Site-directed mutagenesis based on structural insights

    • Substrate binding pocket modification for altered specificity

    • Introduction of disulfide bonds for enhanced stability

    • Surface charge optimization for specific environments

  • Directed evolution approaches:

    • Error-prone PCR for random mutagenesis

    • DNA shuffling with related metalloproteases

    • Compartmentalized self-replication

    • High-throughput screening under application-specific conditions

  • Semi-rational design methods:

    • Consensus design from multiple homologs

    • Ancestral sequence reconstruction

    • Statistical coupling analysis for co-evolving residues

    • Computational design with experimental validation

  • Enzyme immobilization strategies:

    • Covalent attachment to functionalized supports

    • Encapsulation in silica or polymer matrices

    • Cross-linked enzyme aggregates

    • Site-specific immobilization through engineered attachment sites

  • Formulation development:

    • Buffer optimization for long-term stability

    • Lyophilization with appropriate excipients

    • Organic solvent compatibility enhancement

    • Co-formulation with stabilizing agents

These engineering approaches can potentially yield MJ0611 variants with enhanced stability, altered specificity, or improved activity for applications in biocatalysis, bioremediation, or biotechnology.

How can researchers develop inhibitors or modulators specific to MJ0611?

Developing specific inhibitors or modulators for MJ0611 requires a methodical approach that combines structural insights, screening methodologies, and iterative optimization.

  • Inhibitor discovery strategies:

    • Virtual screening against structural models

    • Fragment-based screening approaches

    • High-throughput biochemical assays

    • Natural product library screening

  • Structure-activity relationship development:

    • Systematic modification of lead compounds

    • Quantitative structure-activity relationship modeling

    • Structure-guided optimization

    • Pharmacophore model development

  • Binding mode characterization:

    • X-ray crystallography of enzyme-inhibitor complexes

    • NMR-based binding site mapping

    • Hydrogen-deuterium exchange mass spectrometry

    • Computational docking and molecular dynamics

  • Selectivity profiling:

    • Testing against related metalloproteases

    • Profiling against metalloprotease panels

    • Off-target activity assessment

    • In silico selectivity prediction

  • Specialized inhibitor types:

    • Transition state analogs

    • Mechanism-based inactivators

    • Allosteric modulators

    • Zinc-chelating warheads with specificity elements

The development of specific inhibitors would not only provide valuable research tools for studying MJ0611 function but could also lead to biotechnological applications where precise control of metalloprotease activity is desired.

What emerging technologies could transform our understanding of MJ0611 structure-function relationships?

Emerging technologies across multiple disciplines have the potential to significantly advance our understanding of challenging proteins like MJ0611 from extremophilic organisms.

  • Advanced structural biology methods:

    • Cryo-electron tomography for in situ structural studies

    • Serial femtosecond crystallography at X-ray free electron lasers

    • Integrative structural biology combining multiple data types

    • Microcrystal electron diffraction for small crystals

  • Single-molecule approaches:

    • Single-molecule FRET for conformational dynamics

    • Force spectroscopy for mechanical stability

    • Nanopore analysis for substrate processing

    • Single-molecule activity measurements at high temperatures

  • Advanced computational methods:

    • AI-powered protein structure prediction (AlphaFold-like approaches)

    • Long-timescale molecular dynamics with specialized hardware

    • Quantum mechanical modeling of catalytic mechanisms

    • Deep learning for function prediction from sequence

  • In-cell and in-organism approaches:

    • Development of genetic tools for extremophilic archaea

    • Synthetic biology approaches in model organisms

    • In-cell structural studies (cellular cryo-electron tomography)

    • Metabolic labeling for in vivo substrate identification

  • Next-generation enzyme assays:

    • Microfluidic platforms for high-throughput analysis

    • Droplet-based single enzyme molecule analysis

    • Label-free detection methods

    • Real-time monitoring under extreme conditions

These emerging technologies promise to overcome current limitations in studying extremophilic enzymes and could provide unprecedented insights into the structure, dynamics, and function of MJ0611 in its native-like environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.