Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Biochemical Characterization

Recombinant mtrB is typically expressed in heterologous systems (e.g., E. coli) for structural and functional studies. Key methodologies include:

ParameterDetailsSource
Expression HostEscherichia coli (His-tagged for purification)
Purification MethodAffinity chromatography (e.g., Ni-NTA or Strep-tag systems)
StabilityRequires cofactor binding (e.g., H₄MPT derivatives) for structural integrity
ActivityEnzymatic assays confirm methyltransferase activity in Mtr complex reconstitutions

Phylogenetic and Functional Significance

mtrB is conserved across methanogenic archaea, with paralogs in Methanococcales and Methanomicrobiales reflecting convergent evolution. Notably:

  • Gene Duplication: mtrA paralogs (mtrA-1 and mtrA-2) in Methanomicrobiales and Methanococcales suggest adaptive pressures in energy metabolism .

  • Subunit Interactions: mtrB likely stabilizes the MtrABFG stalk, enabling dynamic interactions with MtrCDE during Na⁺ pumping .

Research Gaps and Future Directions

  1. Lack of Direct mtrB Data: Most structural studies focus on mtrA or MtrCDE; mtrB’s precise role in methyl transfer remains unclear.

  2. Catalytic Mechanism: How mtrB coordinates with other subunits to drive Na⁺ translocation requires further investigation.

  3. Biotechnological Applications: Engineering mtrB for biofuel production or methane mitigation could leverage its Na⁺-pumping efficiency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please specify your preference when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
mtrB; MJ0850; Tetrahydromethanopterin S-methyltransferase subunit B; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
mtrB
Target Protein Sequence
MATYVFIDQNIPLVYTVETGVITKGFGDLLFVDVSPIEEQIKKLETLVDAYEHSLDPRYP PLNSFPNRDGVYAISGYFKSAFFGFWIGLGIMALLAIILGVKF
Uniprot No.

Target Background

Function
This protein is part of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process is an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mja:MJ_0850

STRING: 243232.MJ_0850

Protein Families
MtrB family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) and what is its role in methanogenic archaea?

Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) is one of eight subunits (MtrABCDEFGH) that form the energy-converting N*5-methyl-tetrahydromethanopterin: coenzyme M methyltransferase complex. This multisubunit membrane protein complex couples vectorial Na+ transport with methyl transfer between one-carbon carriers tetrahydromethanopterin and coenzyme M via a vitamin B12 derivative (cobamide) as a prosthetic group . MtrB possesses a single membrane-spanning helix that serves as a membrane anchor and contributes to the central stalk structure of the Mtr complex . This complex plays a critical role in the energy metabolism of methanogenic archaea, utilizing the free energy of the methyl transfer reaction to establish a sodium ion gradient across the membrane .

What is the structural composition and membrane topology of mtrB?

MtrB consists of 100 amino acid residues, with positions B31-B100 being visible in high-resolution cryo-EM structures (2.08 Å) . The protein contains a single membrane-spanning helix that contributes to the central stalk of the Mtr complex, with distinct cytoplasmic (residues 37-56) and membrane (residues 74-100) sections connected by an outward-directed hairpin-shaped linker . In the membrane, the MtrB helix is inclined approximately 20° toward the threefold axis of the complex . The MtrB helix becomes bent outwards by approximately 15° without disturbing the hydrogen bond pattern of the helices, which occurs in coordination with conformational changes in other stalk subunits .

Table 1: Structural Features of MtrB in M. jannaschii

FeatureDetailsReference
Total length100 amino acids
Visible in cryo-EMResidues B31-B100
Cytoplasmic sectionResidues 37-56
Membrane sectionResidues 74-100
Helix inclination~20° toward threefold axis
Helix bending~15° outward

What expression systems are most effective for producing recombinant M. jannaschii mtrB?

For successful expression of recombinant M. jannaschii mtrB, researchers should consider both heterologous and homologous expression systems. The Mtr complex has been successfully expressed in native hosts such as Methanothermobacter marburgensis and Methanothermobacter wolfeii . When designing expression strategies, it is crucial to maintain anaerobic conditions throughout the process due to the methanogenic nature of the host organisms . Expression systems must account for the thermophilic nature of M. jannaschii, with optimal growth temperatures around 85°C. For heterologous expression, specialized vectors containing thermostable selection markers and promoters active at high temperatures are necessary to ensure proper protein folding and assembly into the multisubunit complex.

What are the critical considerations for purifying recombinant mtrB while maintaining structural integrity?

Purification of recombinant mtrB requires careful consideration of several factors to maintain structural integrity. Gentle cell disruption techniques, such as using pseudomurein endopeptidase, are essential to prevent loss of subunits from the complex . For obtaining a highly homogeneous enzyme preparation, treating the complex with dimethyl maleic anhydride for complete removal of MtrH may be beneficial in certain experimental contexts . Throughout purification, maintaining the native lipid environment is crucial, as the cryo-EM structure revealed that tetraether glycolipids fill gaps within the protein scaffold and act as stabilizers . The purification protocol should include appropriate detergents that effectively solubilize the membrane complex without disrupting subunit interactions, followed by chromatographic techniques such as ion exchange and size exclusion chromatography.

How can researchers verify the structural integrity and functional activity of purified recombinant mtrB?

Verification of structural integrity and functional activity requires multiple complementary approaches:

  • SDS-PAGE and mass spectrometry: These techniques confirm the presence and molecular weight of mtrB within the purified complex .

  • Cryo-electron microscopy: This method has been successfully used to determine the structure of the entire Mtr complex at high resolution (2.08 Å), allowing visualization of individual subunits including mtrB .

  • Na+ transport assays: Using sodium-sensitive fluorescent dyes or radioisotope (22Na+) uptake experiments to verify Na+ pumping activity of the complex.

  • Methyl transfer activity: Measuring the transfer of methyl groups from methyl-tetrahydromethanopterin to coenzyme M using radioisotope-labeled substrates or spectroscopic methods.

  • Circular dichroism spectroscopy: This technique verifies the secondary structure, particularly the alpha-helical content characteristic of mtrB.

The purified complex should maintain its characteristic pink color, indicating the presence of the B12 derivative (cobamide) essential for methyl transfer function .

How do conformational changes in mtrB contribute to the energy-coupling mechanism of the Mtr complex?

The conformational changes in mtrB, specifically the outward bending of helices by approximately 15° without disrupting the hydrogen bond pattern, appear to be coordinated with changes in other stalk subunits . This bending occurs in concert with the straightening of inward-inclined MtrG helices at the highly conserved GlyG49, forming a three-helix bundle along the threefold axis . These coordinated movements likely play a crucial role in the mechanism coupling Na+ transport with methyl transfer. Based on the structural data, researchers propose that the energy-coupling mechanism involves transitions between inward-facing and outward-facing conformations of the complex . When methyl-cob(III)amide (His-on) carrying MtrA is strongly attached, it induces an inward-facing conformation, facilitating Na+ flux into the membrane protein center and coenzyme M methylation . Conversely, when loosely attached (or detached) MtrA carrying cob(I)amide (His-off) is present, it induces an outward-facing conformation and extracellular Na+ outflux .

What biophysical techniques provide the most informative data about mtrB-lipid interactions?

Several biophysical techniques are particularly valuable for studying mtrB-lipid interactions:

Table 2: Biophysical Techniques for Studying mtrB-Lipid Interactions

TechniqueInformation ObtainedAdvantages
Cryo-electron microscopyDirect visualization of lipid-protein interfacesRevealed 12 partially disordered tetraether glycolipids within the complex
Mass spectrometry-based lipidomicsIdentification of specifically bound lipidsCan characterize native archaeal lipids co-purifying with the complex
Molecular dynamics simulationsDynamic interactions between mtrB and membrane lipidsCan predict lipid binding sites and conformational effects
Fluorescence spectroscopyLipid binding kinetics and affinityMinimally invasive, can be performed in near-native conditions
Hydrogen-deuterium exchange MSSolvent accessibility changes upon lipid bindingMaps regions of protein affected by lipid interactions

The cryo-EM structure of the Mtr complex has already provided valuable insights, showing that tetraether glycolipids occupy the space between MtrB/MtrF and the MtrAG couple inside the membrane, thereby acting as stabilizers for the complex architecture .

How can site-directed mutagenesis of mtrB inform our understanding of Mtr complex function?

Strategic site-directed mutagenesis of mtrB can provide critical insights into structure-function relationships within the Mtr complex through several approaches:

  • Helix bending mutations: Altering residues involved in the 15° outward bending of the MtrB helix to assess effects on complex assembly and function.

  • Interface mutations: Modifying residues at the interfaces between mtrB and other subunits (particularly MtrF) to probe interaction requirements.

  • Hairpin linker mutations: Changing the flexibility or conformation of the outward-directed hairpin-shaped linker connecting the cytoplasmic and membrane sections to understand its role in conformational changes.

  • Conserved residue analysis: Targeting evolutionarily conserved residues across mtrB homologs from different methanogenic archaea to identify functionally critical positions.

Following mutagenesis, comprehensive characterization should include structural analysis (via cryo-EM), Na+ transport assays, methyl transfer activity measurements, and assessment of complex stability. Mutations that disrupt specific functions without preventing complex assembly would be particularly informative in deciphering the precise role of mtrB in the energy-coupling mechanism.

What assays can quantitatively measure the contribution of mtrB to methyl transfer and Na+ transport activities?

Several assays can quantitatively assess the contribution of mtrB to the dual functions of the Mtr complex:

  • Na+ transport assays: Using Na+-sensitive fluorescent dyes (e.g., SBFI, CoroNa Green) in reconstituted proteoliposomes containing wild-type versus mtrB-mutated complexes. Alternatively, 22Na+ radioisotope flux measurements can provide quantitative data on transport rates and efficiency.

  • Methyl transfer activity: Utilizing radioisotope-labeled substrates (14C-methyl-tetrahydromethanopterin) to measure the transfer of methyl groups to coenzyme M. The reaction can be followed by scintillation counting after separating the products.

  • Coupled enzyme assays: Linking the methyl transfer reaction to other enzymatic processes in the methanogenesis pathway, allowing spectrophotometric monitoring of activity.

  • Conformational change measurements: Employing fluorescence resonance energy transfer (FRET) with strategically placed fluorophores to detect structural changes during the catalytic cycle.

By comparing the activities of complexes containing wild-type versus mutated mtrB, researchers can quantify its specific contributions to each function and identify residues critical for coupling the two processes.

How does mtrB interact with other subunits in the Mtr complex, and what methods best characterize these interactions?

MtrB engages in several key interactions within the Mtr complex that can be characterized using multiple complementary methods:

Table 3: MtrB Interactions and Methods for Their Characterization

Interaction PartnerNature of InteractionCharacterization Methods
MtrFContact along entire stalk Cryo-EM, cross-linking MS, FRET
MtrA/MtrGSeparated in membrane, connected via lipids Cryo-EM, lipid analysis, mutagenesis
MtrEPrimary contact between stalk and MtrCDE globes Cryo-EM, co-immunoprecipitation
Tetraether glycolipidsLipids fill gaps in protein scaffold Cryo-EM, lipidomics, native MS

Cross-linking mass spectrometry can identify specific contact points between subunits, while co-immunoprecipitation or pull-down assays can assess the strength of interactions between wild-type or mutant versions of mtrB and its partners. Hydrogen-deuterium exchange mass spectrometry provides information about solvent-accessible regions and conformational changes in different functional states, which can reveal dynamic aspects of these interactions during the catalytic cycle.

What is the proposed mechanism for mtrB's role in coupling Na+ transport to methyl transfer?

Based on structural and biochemical data, mtrB likely contributes to the coupling mechanism through the following proposed model:

  • Structural support: As part of the central stalk, mtrB provides structural integrity to maintain the appropriate spatial arrangement of catalytic components .

  • Conformational coupling: The bending of MtrB helices outward by approximately 15° occurs in coordination with changes in other subunits, potentially transmitting structural changes during the catalytic cycle .

  • Na+ pathway formation: The central stalk likely contributes to forming the pathway for Na+ movement across the membrane, with mtrB potentially lining part of this channel.

  • Coordination with catalytic events: The methyl transfer occurs via a two-step process: first, methyl transfer from CH3-H4MPT to cob(I)amide, followed by transfer from methylcobamide to coenzyme M . These events are coupled to Na+ transport through conformational changes that involve mtrB.

  • State transitions: The complex alternates between inward-facing and outward-facing conformations, with Na+ flux directions depending on the state of the cobamide cofactor (methyl-cob(III)amide vs. cob(I)amide) . MtrB's conformational changes likely contribute to these state transitions.

While mtrB doesn't directly carry the catalytic cofactors, its structural and dynamic properties appear essential for the coordinated mechanism coupling ion transport with methyl transfer.

What are the major technical challenges in expressing and characterizing recombinant mtrB, and how can they be overcome?

Researchers working with recombinant mtrB face several significant technical challenges:

  • Expression in non-native hosts: M. jannaschii is a hyperthermophilic archaeon with optimal growth at ~85°C under anaerobic conditions, making heterologous expression challenging. Solution: Use thermophilic expression hosts or engineer E. coli strains with specialized chaperones and growth under anaerobic conditions at elevated temperatures.

  • Complex assembly requirements: MtrB functions as part of a multisubunit complex and may not fold properly when expressed alone. Solution: Co-express with key interaction partners, particularly MtrF, to promote proper folding and stability.

  • Membrane protein purification: Extracting and purifying membrane proteins while maintaining native structure is inherently difficult. Solution: Utilize gentle cell disruption methods such as pseudomurein endopeptidase , and optimize detergent selection to maintain complex integrity.

  • Maintaining archaeal lipid environment: The unusual tetraether glycolipids of archaea play a stabilizing role in the complex . Solution: Develop purification methods that preserve these native lipids or add synthetic archaeal lipid analogs during reconstitution.

  • Functional assay sensitivity: Measuring the coupled Na+ transport and methyl transfer activities requires sensitive detection methods. Solution: Develop fluorescence-based assays for real-time monitoring of activity in reconstituted systems.

How can experimental data inconsistencies regarding mtrB structure and function be resolved?

When facing inconsistent experimental data about mtrB structure or function, researchers should employ the following strategies:

  • Method triangulation: Apply multiple independent techniques to address the same question. For structural analysis, complement cryo-EM with techniques such as EPR spectroscopy, hydrogen-deuterium exchange mass spectrometry, and computational modeling.

  • Mutagenesis validation: Design mutations predicted to have specific effects based on competing structural models, then test functional outcomes to discriminate between models.

  • Condition variation: Systematically vary experimental conditions (pH, temperature, ionic strength) to identify factors that might explain apparently contradictory results from different laboratories.

  • Native vs. recombinant comparison: Compare properties of native Mtr complex isolated from M. jannaschii with recombinant versions to identify potential artifacts introduced during heterologous expression.

  • Functional state isolation: Attempt to capture and characterize different functional states of the complex using techniques such as time-resolved cryo-EM or spectroscopy to determine if inconsistencies stem from examining different states of a dynamic system.

  • Comparative analysis: Extend studies to mtrB homologs from related organisms to identify conserved features that likely represent functionally important elements.

What strategies can improve the stability of recombinant mtrB for long-term structural and functional studies?

Improving the stability of recombinant mtrB requires addressing both thermodynamic and kinetic aspects of protein stability:

Table 4: Strategies to Enhance mtrB Stability

StrategyImplementation ApproachExpected Benefit
Archaeal lipid incorporationAdd natural or synthetic archaeal tetraether lipids during purificationMimics native environment where lipids stabilize the complex
Buffer optimizationSystematic screening of pH, ionic strength, and specific ions (esp. Na+)Identifies conditions that maximize conformational stability
Thermostabilizing mutationsIntroduce amino acid substitutions that enhance thermostabilityIncreases half-life at experimental temperatures
Fusion protein approachesCreate fusion constructs with thermostable proteinsMay enhance expression and stability without compromising function
Nanodiscs or SMALPsIncorporate the complex into nanodiscs or styrene-maleic acid lipid particlesProvides a more native-like membrane environment than detergent micelles
Cryoprotectant formulationDevelop specialized buffer compositions for freezingPrevents damage during freeze-thaw cycles for long-term storage

Stability during functional assays can be enhanced by conducting experiments at elevated temperatures that more closely match the physiological conditions of M. jannaschii. Additionally, the identification and removal of proteolytically sensitive regions through careful construct design can improve sample homogeneity and long-term stability.

How can structural insights from mtrB research inform the design of biomimetic energy-converting systems?

The unique energy-converting mechanism of the Mtr complex, to which mtrB contributes, offers valuable principles for designing biomimetic systems:

  • Modular coupling design: The Mtr complex demonstrates how structural modules (the central stalk containing mtrB and the MtrCDE globes) can be arranged to couple chemical reactions with ion transport . This modular approach could be emulated in synthetic systems.

  • Conformational energy transduction: The coordinated conformational changes in mtrB and other stalk subunits demonstrate how protein structural rearrangements can transduce energy from chemical reactions to generate ion gradients . Synthetic proteins could be designed to undergo similar conformational switches.

  • Lipid-protein interface engineering: The stabilizing role of tetraether glycolipids in the Mtr complex highlights the importance of lipid-protein interfaces in energy-converting systems. Biomimetic membranes could incorporate specialized lipids to stabilize and modulate the function of membrane protein complexes.

  • Methyl transfer energetics: The coupling of methyl transfer to Na+ pumping provides a blueprint for harnessing chemical energy from reactions with favorable thermodynamics to drive ion transport. Similar coupling mechanisms could be engineered into synthetic energy-converting systems.

  • Trimeric symmetry utilization: The threefold symmetry of the Mtr complex, with the central stalk containing mtrB , suggests advantages of multimeric assemblies in energy conversion, potentially offering cooperative effects that could be incorporated into designed systems.

What comparative insights can be gained by studying mtrB homologs across different methanogenic archaea?

Comparative analysis of mtrB homologs across different methanogenic archaea can provide valuable insights:

  • Conservation mapping: Identifying highly conserved residues across diverse species points to functionally critical regions of mtrB. These conserved elements likely play essential roles in the energy-coupling mechanism.

  • Adaptation to different environments: Comparing mtrB from psychrophilic, mesophilic, and hyperthermophilic methanogens reveals adaptations to different thermal environments, informing protein engineering for temperature stability.

  • Subtypes and specializations: Some methanogens contain multiple mtr operons or variant forms, potentially specialized for different substrates or conditions. Studying these variants can reveal functional diversity within the Mtr system.

  • Co-evolution patterns: Analyzing co-evolutionary relationships between mtrB and other Mtr subunits across species can identify interacting regions that have evolved together, providing insight into essential protein-protein interfaces.

  • Structural conservation vs. variation: Determining which structural features of mtrB are invariant across species and which show variability helps distinguish essential functional elements from adaptable regions.

This comparative approach has been particularly valuable in understanding other enzyme complexes involved in methanogenesis and could similarly illuminate the role of mtrB in the Mtr complex.

How might advanced computational methods complement experimental approaches in understanding mtrB function?

Advanced computational methods offer powerful complementary approaches to experimental studies of mtrB:

  • Molecular dynamics simulations: Using the high-resolution cryo-EM structure (2.08 Å) as a starting point, simulations can reveal dynamic aspects of mtrB's interactions with other subunits, lipids, and Na+ ions during the catalytic cycle.

  • Quantum mechanical calculations: For studying the energetics of methyl transfer reactions coupled to Na+ transport, quantum mechanical methods can provide insights into transition states and energy barriers that are difficult to capture experimentally.

  • Coarse-grained modeling: Simplified representations of the Mtr complex can enable simulation of longer timescale phenomena, such as large conformational changes during the coupling mechanism.

  • Machine learning approaches: Analysis of sequence-structure-function relationships across many mtrB homologs using machine learning algorithms can identify subtle patterns correlated with functional properties.

  • Network analysis: Treating the Mtr complex as a network of interacting components can reveal allosteric pathways through which conformational changes propagate from the methyl transfer site to Na+ transport channels.

  • Integrative modeling: Combining data from multiple experimental sources (cryo-EM, cross-linking, HDX-MS, functional assays) within a computational framework can generate comprehensive models of mtrB function within the complex.

These computational approaches are particularly valuable for testing hypotheses about dynamic processes that occur on timescales difficult to capture experimentally, thereby guiding the design of new experimental studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.