Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit D (mtrD)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Characteristics

MtrD is encoded by the mtrD gene (also designated MJ_RS04550 or MJ0848) in Methanocaldococcus jannaschii, a hyperthermophilic archaeon isolated from deep-sea hydrothermal vents . Key genetic and molecular features include:

PropertyDetails
Gene NamemtrD (MJ_RS04550, MJ0848)
Protein FunctionSubunit of the Mtr methyltransferase complex
Enzyme Commission (EC)2.1.1.86 (methyltransferase activity); 7.2.1.4 (coupled sodium-ion transport)
Host Systems for ExpressionE. coli, Yeast, Baculovirus, Mammalian Cells, Cell-Free Expression
Purity≥85% (determined by SDS-PAGE)

Functional Role in Methanogenesis

MtrD contributes to the energy-conserving step of methanogenesis:

  1. Methyl Transfer: Catalyzes the exergonic transfer of a methyl group from methyl-tetrahydromethanopterin to coenzyme M, yielding methyl-coenzyme M and tetrahydromethanopterin .

  2. Sodium Ion Translocation: Couples methyl transfer with the outward transport of sodium ions, generating an electrochemical gradient used for ATP synthesis .

This dual functionality is critical for the survival of M. jannaschii in extreme environments .

Recombinant Production and Applications

Recombinant MtrD is produced using diverse expression systems:

Expression SystemApplications
E. coliHigh-yield production for structural studies
Cell-Free ExpressionFunctional studies of membrane protein complexes
Mammalian CellsInvestigation of enzyme kinetics and inhibitor screening

Research Applications:

  • Mechanistic Studies: Elucidating sodium-ion pumping and methyl transfer mechanisms .

  • Biotechnology: Engineering methane metabolism pathways for biofuel production .

Key Research Findings

  1. Cryo-EM Structure: The 2.08 Å resolution structure revealed tetraether glycolipids within the Mtr complex, stabilizing its architecture in hyperthermophilic conditions .

  2. Evolutionary Significance: The Mtr complex’s structure supports the hypothesis of an early evolutionary origin of ion-coupled methanogenesis .

  3. Disorder in MtrA: The soluble MtrA domain (containing cobalamin) is structurally disordered in isolation but becomes ordered upon complex formation .

Future Directions

  • Inhibitor Development: Targeting MtrD could reduce methane emissions from archaea in ruminants .

  • Structural Dynamics: Time-resolved studies to map conformational changes during ion translocation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrD; MJ0848; Tetrahydromethanopterin S-methyltransferase subunit D; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
mtrD
Target Protein Sequence
MDIVSAIVPLIEMTIAGAIINASVHFIPVGGAPAAMATSTGVGTGTTQLAAGAGFTGLMG AAVMASNVGLSPIGMALIMISGAVSSMIMLGVTMLIGQLIYVFGVGVVPAADKCEIDPIT KDPQKPYVTPGTTGHGVPTVCFVSGLIGAALGGIGGALAYIALRKLGLDPGVAGMLAVGF FFINAVLASYNIGGTIEGFHDPKFKKMPNGVIASTVASLLFGIISVLMVL
Uniprot No.

Target Background

Function
This protein is a component of a complex that catalyzes the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This reaction represents an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mja:MJ_0848

STRING: 243232.MJ_0848

Protein Families
MtrD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Tetrahydromethanopterin S-methyltransferase in methanogenic archaea?

Tetrahydromethanopterin S-methyltransferase catalyzes the transfer of methyl groups from methyl-tetrahydromethanopterin to 2-mercaptoethanesulfonate (CoM), a critical step in the methanogenesis pathway. This enzyme is oxygen-sensitive with a defined pH optimum of approximately 6.7 and demonstrates reversible catalytic activity. The reaction product, methyl-CoM, can be identified through techniques such as TLC and high voltage paper electrophoresis . The enzyme's methyltransferase activity is essential for energy conservation in methanogens, as it contributes to the establishment of a sodium ion gradient across the cell membrane during methanogenesis.

What expression systems are most suitable for producing recombinant M. jannaschii mtrD?

Both heterologous and homologous expression systems can be utilized for producing recombinant M. jannaschii mtrD, each with distinct advantages:

Homologous Expression in M. jannaschii:

  • Provides proper folding and post-translational modifications native to the archaeal system

  • Can be achieved using linearized suicide plasmids for genome integration via double crossover homologous recombination

  • Allows for the addition of affinity tags (e.g., 3xFLAG-twin Strep tag) to facilitate purification

  • Transformation requires heat shock rather than chemical treatments like polyethylene glycol or liposomes

  • Yields functional protein with native conformation suitable for structural studies

Heterologous Expression in E. coli:

  • More accessible for most researchers but may require codon optimization

  • Requires careful consideration of temperature conditions during expression

  • Often results in lower specific activity compared to homologously expressed protein

  • May require refolding protocols to achieve proper protein conformation

How can selective pressure analysis tools like MTR be applied to study evolutionary conservation of mtrD across methanogenic archaea?

Missense Tolerance Ratio (MTR) analysis can reveal regions within the mtrD gene under purifying selection, indicating functional importance . To apply this approach:

  • Collect genomic sequences of mtrD homologs from multiple methanogenic archaea

  • Calculate MTR scores using sliding windows across the sequence alignment

  • Identify regions with low MTR scores, indicating intolerance to missense variations

  • Compare these conserved regions with known functional domains and interaction sites

Table 1: Example MTR Analysis of Hypothetical mtrD Regions

Region (amino acids)MTR ScoreFunctional SignificanceConservation Across Methanogens
15-400.42Membrane interactionHigh
75-950.23Cofactor bindingVery High
120-1450.78Variable regionLow
185-2100.31Subunit interfaceHigh
250-2750.19Catalytic contributionVery High

Note: Lower MTR scores indicate regions under stronger purifying selection

What strategies can overcome the oxygen sensitivity challenges when working with recombinant M. jannaschii mtrD?

The oxygen sensitivity of Tetrahydromethanopterin S-methyltransferase presents significant challenges for recombinant expression and functional studies . Implement these strategies to maintain enzyme integrity:

  • Anaerobic Expression Systems:

    • Utilize specialized anaerobic chambers for all cultivation and protein purification steps

    • Consider expression in facultative or obligate anaerobes as host organisms

  • Buffer Optimization:

    • Include reducing agents such as dithiothreitol (DTT), β-mercaptoethanol, or dithionite

    • Maintain buffers at the optimal pH of 6.7 to maximize stability

    • Consider adding glycerol (10-20%) to stabilize protein structure

  • Rapid Purification Protocols:

    • Design purification strategies that minimize exposure time

    • Utilize affinity tags (as demonstrated with the FLAG-twin Strep tag system) for efficient single-step purification

    • Perform all chromatography steps in anaerobic glove boxes with oxygen-scrubbed buffers

  • Activity Preservation Techniques:

    • Flash-freeze purified protein in liquid nitrogen and store under argon

    • Add oxygen-scavenging enzyme systems to reaction mixtures

    • Consider stabilizing protein-protein interactions by co-expressing multiple subunits

How does the thermal stability of recombinant mtrD compare between homologous and heterologous expression systems?

Given M. jannaschii's hyperthermophilic nature (optimal growth at ~85°C), expression system choice significantly impacts thermal stability of recombinant mtrD:

Homologous Expression:

  • Proteins expressed in M. jannaschii retain native hyperthermophilic characteristics

  • Maintain activity at temperatures up to 85°C with minimal denaturation

  • Exhibit specific activities up to 38 times higher than heterologously expressed counterparts

  • Show resistance to thermal denaturation consistent with the native enzyme

Heterologous Expression:

  • Often show compromised thermal stability due to incorrect folding or missing post-translational modifications

  • May require engineering of stabilizing mutations or co-expression of chaperones

  • Typically demonstrate lower specific activity at elevated temperatures

  • May unfold at temperatures significantly below the optimal growth temperature of M. jannaschii

To maximize thermal stability of heterologously expressed mtrD, consider co-expressing with archaeal chaperones or using specialized E. coli strains adapted for expression of thermophilic proteins.

What genetic manipulation strategies are most effective for creating recombinant M. jannaschii strains expressing tagged mtrD?

Based on successful genetic manipulations in M. jannaschii, the following strategies have proven effective:

  • Linear Suicide Vector Approach:

    • Design plasmids containing upstream and 5'-end coding regions of the target gene (mtrD) to enable double crossover homologous recombination

    • Include affinity tag sequences (e.g., 3xFLAG-twin Strep tag) in-frame with the coding sequence

    • Linearize the vector before transformation to prevent merodiploid formation

    • Use selectable markers such as mevinolin resistance for selection of transformants

  • Promoter Selection:

    • Utilize the native promoter for regulated expression or strong constitutive promoters for overexpression

    • The methyl-coenzyme M reductase operon promoter (PmcrB) has been successfully used for unregulated gene expression

    • The engineered P* promoter has also shown effectiveness for controlled expression

  • Transformation Protocol:

    • Apply heat shock treatment for transformation rather than chemical methods

    • Plate transformants on solid medium containing appropriate selective agents

    • Colonies can typically be observed within 3-4 days, significantly faster than with other methanogenic archaea (Methanosarcina species require ~14 days)

  • Verification Strategies:

    • Confirm successful integration using PCR-based analysis of chromosomal DNA

    • Verify protein expression through Western blot analysis using antibodies against the affinity tag

    • Validate protein identity using mass spectrometric analysis of purified protein digests

What are the optimal conditions for measuring recombinant mtrD activity in vitro?

To accurately measure the activity of recombinant mtrD as part of the Tetrahydromethanopterin S-methyltransferase complex:

  • Buffer Composition:

    • Maintain strict anaerobic conditions throughout the assay

    • Use buffers with pH 6.7, which represents the enzyme's pH optimum

    • Include reducing agents and divalent cations as necessary cofactors

  • Temperature Selection:

    • Conduct assays at 70-85°C to match M. jannaschii's physiological temperature range

    • Include temperature controls to account for non-enzymatic rates at high temperatures

    • Ensure all equipment and solutions are pre-heated to prevent temperature fluctuations

  • Substrate Preparation:

    • Prepare methyl-tetrahydromethanopterin under strictly anaerobic conditions

    • Maintain 2-mercaptoethanesulfonate (CoM) in reduced form

    • Consider optimal substrate concentrations (typically 20-40 μM for related enzymes)

  • Activity Measurement Techniques:

    • Monitor reaction progress by tracking substrate depletion or product formation

    • Analyze methyl-CoM formation by TLC or high voltage paper electrophoresis

    • Consider coupled enzyme assays to provide continuous measurement options

  • Controls:

    • Include heat-inactivated enzyme controls (heating to 100°C for 5 minutes completely inactivates the enzyme)

    • Test bidirectionality of the reaction by providing methyl-CoM and tetrahydromethanopterin

    • Include negative controls lacking individual substrates or cofactors

How can researchers troubleshoot low expression yields of recombinant mtrD?

When facing low expression yields of recombinant mtrD, researchers should systematically address potential issues:

For Homologous Expression in M. jannaschii:

  • Genomic Integration Verification:

    • Confirm successful integration using multiple PCR primer pairs

    • Verify orientation and sequence integrity of the integrated construct

    • Rule out merodiploid formation through Southern blot analysis

  • Promoter Optimization:

    • Test different promoter strengths to balance expression with cellular toxicity

    • Consider inducible promoter systems if constitutive expression is problematic

    • Evaluate the effect of chromosomal position on expression levels

  • Culture Conditions:

    • Optimize growth conditions specifically for protein expression

    • Monitor growth rates to identify potential toxic effects of overexpression

    • Adjust harvest timing to capture peak expression periods

For Heterologous Expression:

  • Codon Optimization:

    • Analyze codon usage patterns in M. jannaschii versus the host organism

    • Optimize codons for rare tRNAs or co-express these tRNAs

    • Consider the impact of mRNA secondary structure on translation efficiency

  • Solubility Enhancement:

    • Test expression at lower temperatures to reduce inclusion body formation

    • Co-express archaeal chaperones to assist proper folding

    • Explore fusion protein approaches with solubility-enhancing tags

  • Purification Optimization:

    • Compare affinity tag positions (N-terminal vs. C-terminal)

    • Evaluate tag interference with protein folding or activity

    • Optimize purification conditions to maximize recovery of active protein

How should researchers interpret kinetic data from recombinant mtrD compared to native enzyme complexes?

When analyzing kinetic data from recombinant mtrD compared to native enzyme complexes, consider these key interpretative frameworks:

  • Activity Comparison Metrics:

    • Calculate apparent specific activity (μmol/min/mg) under standardized conditions

    • Compare values to literature benchmarks (e.g., native FprA from Methanobrevibacter arboriphilus or recombinant Methanothermobacter marburgensis FprA)

    • Normalize activity to active site concentration rather than total protein concentration when possible

  • Context-Dependent Interpretation:

    • Homologously expressed M. jannaschii proteins typically show higher specific activities (up to 38 times higher) than heterologously expressed counterparts

    • Consider the integrity of the multi-subunit complex in recombinant systems

    • Evaluate potential cofactor limitations in recombinant systems

  • Physicochemical Parameter Analysis:

    • Compare temperature optima and stability profiles between recombinant and native forms

    • Assess pH dependence curves to identify potential structural differences

    • Analyze substrate affinity parameters (Km values) as indicators of active site integrity

Table 2: Comparative Analysis of Enzyme Activities from Different Expression Systems

Expression SystemHost OrganismSpecific Activity (μmol/min/mg)Temperature Optimum (°C)pH OptimumStability (t1/2 at 80°C)
HomologousM. jannaschii~2,100856.7>120 min
HeterologousE. coli~100-20070-756.5-7.015-30 min
NativeM. arboriphilus~55376.7<5 min

Note: Values are approximated based on comparable enzymes from methanogenic archaea

What computational approaches can predict structure-function relationships in recombinant mtrD?

Modern computational approaches offer powerful insights into mtrD structure-function relationships:

  • Homology Modeling:

    • Build structural models based on related methyltransferases with known structures

    • Refine models using molecular dynamics simulations under conditions mimicking hyperthermophilic environments

    • Validate model quality using tools like PROCHECK, VERIFY3D, and QMEANDisCo

  • Conservation Analysis:

    • Apply tools like MTR-Viewer to identify regions under purifying selection

    • Analyze sequence conservation patterns across different methanogenic archaea

    • Map conserved residues onto structural models to identify functional hotspots

  • Molecular Dynamics Simulations:

    • Simulate protein behavior at high temperatures (85°C) to understand thermostability mechanisms

    • Model cofactor binding and substrate interactions in the active site

    • Evaluate conformational changes during the catalytic cycle

  • Protein-Protein Interaction Prediction:

    • Model interactions between mtrD and other subunits of the methyltransferase complex

    • Identify key residues at subunit interfaces that contribute to complex stability

    • Predict the impact of mutations at these interfaces on complex assembly and function

  • Machine Learning Approaches:

    • Train models on known methyltransferase data to predict activity based on sequence features

    • Identify patterns in amino acid composition that contribute to thermostability

    • Predict optimal expression conditions based on protein sequence characteristics

How can researchers resolve discrepancies between in vitro and in vivo activity measurements of recombinant mtrD?

When facing discrepancies between in vitro and in vivo activity measurements of recombinant mtrD, consider these resolution strategies:

  • Physiological Context Reconstruction:

    • Supplement in vitro assays with cellular components that may be missing (membrane fractions, cofactors)

    • Adjust ionic conditions to match the intracellular environment of M. jannaschii

    • Consider the impact of molecular crowding agents on enzyme activity

  • Integrated Analysis Approach:

    • Combine biochemical assays with transcriptomic and metabolomic data

    • Correlate expression levels with metabolic flux changes

    • Use isotope labeling to track methyl transfer in vivo versus in vitro

  • Complex Integrity Validation:

    • Verify the assembly state of the multi-subunit complex in different contexts

    • Assess post-translational modifications that may differ between systems

    • Evaluate the impact of membrane association on enzyme function

  • Methodological Reconciliation:

    • Standardize measurement conditions as much as possible between systems

    • Account for differences in substrate accessibility between in vitro and in vivo environments

    • Consider the impact of cellular regulatory mechanisms on in vivo activity

How might CRISPR-Cas9 techniques be adapted for more precise genetic manipulation of M. jannaschii mtrD?

While CRISPR-Cas9 systems have revolutionized genetic engineering in many organisms, their application to hyperthermophilic archaea like M. jannaschii presents unique challenges and opportunities:

  • Thermostable CRISPR Components:

    • Identify naturally thermostable Cas9 variants from thermophilic bacteria or archaea

    • Engineer existing Cas9 proteins for enhanced thermostability through directed evolution

    • Consider alternative CRISPR systems (Cpf1/Cas12a) that may have better thermal stability

  • Delivery Methods:

    • Adapt the existing heat shock transformation protocol for M. jannaschii to deliver CRISPR components

    • Develop transient expression systems for Cas9 to minimize potential toxicity

    • Explore liposome-mediated delivery specifically optimized for hyperthermophiles

  • Guide RNA Stability:

    • Design guide RNAs with enhanced thermal stability through chemical modifications

    • Optimize guide RNA expression using archaeal promoters and terminators

    • Consider direct delivery of ribonucleoprotein complexes rather than encoding components genetically

  • Precision Editing Applications:

    • Develop markerless gene editing approaches for multiple modifications of the mtr operon

    • Create domain swaps between different methanogen mtrD homologs to study function

    • Engineer precise point mutations to test structure-function hypotheses

  • Validation Strategies:

    • Implement deep sequencing to detect off-target effects at high temperatures

    • Develop reporter systems functional in M. jannaschii to monitor editing efficiency

    • Compare CRISPR editing efficiency to traditional homologous recombination approaches

What are the most promising applications of recombinant mtrD in understanding methanogenesis pathways?

Recombinant mtrD offers several promising applications for advancing our understanding of methanogenesis:

  • Structure-Function Analysis:

    • Determine high-resolution structures of the complete methyltransferase complex

    • Map the electron transfer pathway within the complex

    • Identify key residues involved in methyl group transfer and ion coupling

  • Evolutionary Studies:

    • Examine functional conservation across methanogen lineages

    • Reconstruct ancestral sequences to understand the evolution of methanogenesis

    • Study adaptation mechanisms to different environmental conditions (temperature, pressure)

  • Bioenergetics Research:

    • Quantify the energy conservation efficiency of the methyl transfer reaction

    • Characterize the sodium ion translocation mechanism coupled to methyl transfer

    • Develop mathematical models of the complete methanogenesis pathway

  • Synthetic Biology Applications:

    • Engineer optimized methyl transfer systems for biofuel production

    • Develop biosensors based on methyl transfer activity

    • Create minimal synthetic systems that recapitulate key aspects of methanogenesis

  • Climate Science Connections:

    • Understand the molecular basis of methane production in different environments

    • Investigate potential inhibition mechanisms relevant to climate change mitigation

    • Study adaptation mechanisms of methanogens to changing environmental conditions

By pursuing these research directions, scientists can leverage recombinant mtrD to advance our fundamental understanding of archaeal metabolism while potentially developing applications relevant to biotechnology and climate science.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.