Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase Subunit E (mtrE)

Methanocaldococcus jannaschii is a hyperthermophilic methanogen, known for its ability to thrive in extreme environments such as deep-sea hydrothermal vents. This archaeon plays a crucial role in understanding ancient metabolic pathways and has been extensively studied for its genetic and metabolic features . The Tetrahydromethanopterin S-methyltransferase complex is essential in the methanogenesis pathway of M. jannaschii, where it facilitates the transfer of methyl groups, a critical step in methane production.

Role of Tetrahydromethanopterin S-methyltransferase in Methanogenesis

Tetrahydromethanopterin S-methyltransferase is a key enzyme in the methanogenesis pathway, responsible for transferring methyl groups from methanol or methylamines to tetrahydromethanopterin (H4MPT), which is then further processed to produce methane . This enzyme complex is crucial for the energy metabolism of methanogens like M. jannaschii.

Research Findings and Genetic Studies

While specific studies on the recombinant mtrE subunit are scarce, genetic systems for Methanocaldococcus jannaschii have been developed to study its metabolic pathways and genetic manipulation . These systems allow researchers to explore the functions of various genes, including those involved in methanogenesis.

AspectDescriptionRelevance to mtrE
Genetic SystemAllows for genetic manipulation of M. jannaschii to study metabolic pathways.Potential tool for studying mtrE function.
Methanogenesis PathwayCritical for energy production in methanogens.mtrE plays a role in this pathway.
Hyperthermophilic EnvironmentM. jannaschii thrives in extreme conditions, mimicking early Earth environments.Understanding how mtrE functions under these conditions is crucial.

Challenges and Future Directions

Studying recombinant enzymes like mtrE from M. jannaschii poses several challenges, including the need for specialized equipment to handle high-temperature conditions and the complexity of genetic manipulation in archaea. Future research should focus on developing more efficient genetic tools and expressing recombinant mtrE in suitable host organisms to elucidate its structure and function.

References

  • General information on Archaeans and Methanocaldococcus jannaschii.
    - Crystal structure of MtrE from Neisseria gonorrhoeae, which may provide insights into structural aspects of similar proteins.
    - Genetic systems and metabolic pathways of Methanocaldococcus jannaschii.
    - Archaeal cell envelope and surface structures, relevant to understanding the cellular context of mtrE.
    - MtrE protein from Neisseria gonorrhoeae, highlighting efflux transmembrane transporter activity.
    - Growth kinetics and gene expression in Methanocaldococcus jannaschii under varying conditions.
    - Modulation of the MtrE efflux conduit in Neisseria gonorrhoeae, which could inform studies on similar proteins.
    - Metabolic activity and methane production in Methanocaldococcus jannaschii.
    - Involvement of the gonococcal Mtr system, providing context for efflux systems in bacteria.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: Our standard shipping protocol includes blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mtrE; MJ0847; Tetrahydromethanopterin S-methyltransferase subunit E; N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
mtrE
Target Protein Sequence
MDATLIALGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISG EPVSYGLYVAVAGTVAYAIMQMGLNPILALILGAGVAAFVHGAYAISAYLGRIVGQSKNF GQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILGNPFPLPLIALIFGITVGAIGS STGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCF GLIVFLDGWRGVLGDILKGGQGGSVITASIISIVIGLIIVAILAIINRKVEVFARNKYGP YTK
Uniprot No.

Target Background

Function
This protein is a component of a complex that facilitates the formation of methyl-coenzyme M and tetrahydromethanopterin from coenzyme M and methyl-tetrahydromethanopterin. This process represents an energy-conserving, sodium-ion translocating step.
Database Links

KEGG: mja:MJ_0847

STRING: 243232.MJ_0847

Protein Families
MtrE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of mtrE in the methane-producing pathway of M. jannaschii?

MtrE serves as one of the integral membrane subunits within the larger MtrABCDEFGH complex in M. jannaschii. This complex catalyzes a critical reaction in methanogenesis: the transfer of a methyl group from N5-methyl-tetrahydromethanopterin (CH3-H4MPT) to coenzyme M (CoM) via a vitamin B12 derivative. This reaction is considered the most universal electrogenic reaction in methane-producing energy metabolism of archaea. MtrE specifically contributes to forming the membrane-spanning portion of the complex that facilitates the coupling of this methyl transfer with Na+ transport across the membrane . This coupling mechanism is fundamental to energy conservation in these organisms, as the generated ion gradient can be utilized for ATP synthesis. The process involves a two-step reaction where the methyl group is first transferred from CH3-H4MPT to cob(I)amide, changing the oxidation state from Co(I) to Co(III), and then from CH3-cob(III)amide to CoM, returning to Co(I) .

How is mtrE structurally integrated into the MtrABCDEFGH complex?

Recent cryo-EM studies at 2.08 Å resolution reveal that mtrE is part of the membrane-spanning MtrCDE "globes" that symmetrically flank a central Mtr(ABFG)3 stalk in a trimeric complex arrangement . The complete Mtr(ABCDEFG)3 complex has a molecular mass of approximately 430 kDa when devoid of MtrH . MtrE works in conjunction with MtrC and MtrD to form the transmembrane elements that create a cytoplasmic cavity. This cavity appears to contain the binding site for coenzyme M and Na+ ions, with these components identified inside or in a side-pocket of the cavity formed within the MtrCDE units . Tetraether glycolipids were also visible in the cryo-EM map, filling gaps inside the multisubunit complex and likely contributing to its stability in the membrane environment .

What evolutionary significance does mtrE hold among methanogenic archaea?

The MtrABCDEFGH complex, including mtrE, represents a conserved mechanism for energy conservation across methanogenic archaea, having been extensively studied in organisms such as Methanothermobacter marburgensis and Methanosarcina mazei in addition to M. jannaschii . This conservation suggests that the sodium-pumping methyltransferase mechanism is an ancient and fundamental trait in methanogens. M. jannaschii itself is a thermophilic archaeon that was isolated from hydrothermal vents at depths of 2600 m near the western coast of Mexico, where it thrives in extreme environments with temperatures ranging from 48-94°C . As the first archaeon to have its complete genome sequenced, M. jannaschii has revealed many genes unique to the archaeal domain . The conservation of mtrE across methanogens living in such diverse environments highlights its essential role in a metabolic pathway that has been maintained throughout archaeal evolution.

What are effective strategies for expressing recombinant mtrE in heterologous systems?

Successfully expressing recombinant mtrE requires addressing several challenges inherent to membrane proteins from hyperthermophilic archaea. An effective approach involves using the native M. jannaschii mtrE promoter (PmjmtrE) for controlled expression. In genetic studies, researchers have successfully amplified the mtrE promoter region using PCR, followed by restriction enzyme digestion and ligation to create functional gene fusions . For heterologous expression in E. coli, codon optimization is essential given the significant differences in codon usage between archaeal and bacterial systems.

Expression conditions should account for mtrE's thermophilic origin. Induction at moderately elevated temperatures (30-37°C) often provides a balance between proper folding and avoiding inclusion body formation. Expression vectors containing thermostable selection markers have proven valuable when working with M. jannaschii genes. For example, research has successfully used constructs like pJALv3s1 (Pmjmtr::kat Pmjmcr::hpt) to express genes under control of M. jannaschii promoters .

What purification approaches maintain the structural integrity of membrane-bound mtrE?

Purification of membrane proteins like mtrE requires specialized techniques to maintain their native conformation. Initial extraction involves careful solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin, which have been successful with other membrane components of the Mtr complex. Following solubilization, affinity chromatography using engineered tags (His6 or Strep-tag) facilitates initial purification.

For structural studies, researchers have effectively used the intact MtrABCDEFG complex (which includes mtrE) with a molecular mass of 430 kDa . This approach recognizes that individual subunits may not maintain their proper conformation when isolated from their binding partners. Size-exclusion chromatography as a final purification step helps separate the properly assembled complex from aggregates and unassembled components.

For functional studies, it's critical to preserve the native lipid environment. Techniques such as nanodisc reconstitution or liposome incorporation have proven valuable for maintaining the functional properties of membrane-bound methyltransferase components similar to mtrE.

How can researchers measure the specific activity of mtrE within the MtrABCDEFGH complex?

Measuring the specific activity of mtrE within the MtrABCDEFGH complex requires assays that can detect either methyl transfer or Na+ transport, as these processes are coupled. One established approach is to reconstitute the purified complex into liposomes and measure Na+ uptake using Na+-specific fluorescent dyes or radioactive 22Na+. This method can detect the electrogenic nature of the reaction as it couples methyl transfer with ion movement .

For methyl transfer activity, researchers can employ assays that monitor the conversion of methyl-H4MPT to H4MPT and methyl-CoM. This typically involves spectrophotometric methods or HPLC analysis with appropriate detection methods. These assays should be conducted under strictly anaerobic conditions as oxygen can interfere with the redox-sensitive methyl transfer reactions and the cobamide cofactor.

To specifically assess mtrE's contribution, comparative studies using complexes with wild-type versus mutated mtrE can reveal its specific role. Site-directed mutagenesis of conserved residues suspected to be involved in Na+ binding or translocation can provide valuable insights into structure-function relationships.

What methods can detect conformational changes in mtrE during the catalytic cycle?

Detecting conformational changes in mtrE during catalysis requires techniques sensitive to protein structural dynamics. Cryo-EM has already provided valuable structural information about the MtrCDE membrane components, revealing that the bottom of the cytoplasmic cavity formed by these subunits marks the gate of a transmembrane pore that appears occluded in the static structure .

Dynamic studies suggest that the complex may alternate between inward-facing and outward-facing conformations during the catalytic cycle. This conformational shifting is hypothetically linked to the methylation state of the cobamide cofactor carried by MtrA, which interacts with the MtrCDE components . Specifically, the model suggests that strongly attached methyl-cob(III)amide (His-on state) carrying MtrA induces an inward-facing conformation and Na+ flux into the membrane protein center, while the subsequently generated loosely attached MtrA carrying cob(I)amide (His-off state) induces an outward-facing conformation and extracellular Na+ outflux .

Techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS), site-specific fluorescence labeling, or double electron-electron resonance (DEER) spectroscopy could theoretically be applied to monitor these conformational dynamics in real-time during the catalytic cycle.

How does the structural arrangement of mtrE contribute to Na+ transport?

The cryo-EM structure of the Mtr complex provides insights into how mtrE and its membrane partners (MtrC and MtrD) create a pathway for Na+ transport. The MtrCDE components form a cytoplasmic cavity where putative coenzyme M and Na+ binding sites were identified . The bottom of this cavity marks the gate of a transmembrane pore, which appears occluded in the static cryo-EM structure but likely opens during the catalytic cycle .

The current model for Na+ transport suggests a mechanism where the methylation state of the cobamide cofactor carried by MtrA influences the conformation of the MtrCDE membrane components, transitioning between inward-facing and outward-facing states . When MtrA carries methyl-cob(III)amide in the His-on state, it induces an inward-facing conformation that allows Na+ flux into the center of the membrane protein. Following methyl transfer to coenzyme M, MtrA transitions to carrying cob(I)amide in the His-off state, which induces an outward-facing conformation facilitating Na+ outflux to the extracellular space .

This alternating access mechanism provides a structural basis for understanding how the energy of methyl transfer can be transduced into an electrochemical Na+ gradient across the membrane, which is essential for ATP synthesis in these organisms.

Methylation StateMtrA ConfigurationMtrCDE ConformationNa+ Movement
Methyl-cob(III)amide (His-on)Strongly attachedInward-facingNa+ flux into membrane center
Cob(I)amide (His-off)Loosely attached/detachedOutward-facingNa+ outflux to extracellular space

What insights have genetic studies provided about mtrE function?

Genetic studies have employed the M. jannaschii mtrE promoter (PmjmtrE) as a tool for gene expression in experimental systems . Researchers have constructed plasmids containing the mtrE promoter fused to reporter genes such as kanamycin resistance (kat) to create functional genetic tools. In one study, the construct pJALv3s1 (Pmjmtr::kat Pmjmcr::hpt) was developed as part of a genetic system for studying hyperthermophilic methanogens .

These genetic approaches can be extended to functional studies of mtrE itself. By creating targeted mutations in conserved residues and assessing their impact on methane production, Na+ transport, or cell viability, researchers can identify critical functional domains. Additionally, complementation studies using recombinant mtrE variants can restore function in mutant strains, confirming the specific contribution of mtrE to methanogenesis.

The genetic manipulation of M. jannaschii is challenging due to its extreme growth requirements, but recent advances in genetic tools for related methanogens provide promising methodologies. These approaches are essential for moving beyond structural studies to understand the in vivo significance of specific mtrE features.

How does mtrE function integrate with broader methanogenesis pathways?

M. jannaschii is a strict hydrogenotroph that can only grow using carbon dioxide and hydrogen as primary energy sources, unlike some other methanogens that can also utilize formate . The genome encodes multiple hydrogenases, including a 5,10-methenyltetrahydromethanopterin hydrogenase, a ferredoxin hydrogenase (eha), and a coenzyme F420 hydrogenase . These enzymes generate the reduced cofactors needed for the reduction of CO2 to methane through a series of enzymatic steps, with the Mtr complex catalyzing a mid-pathway reaction.

What role might mtrE play in oxidative stress responses in M. jannaschii?

While M. jannaschii is an obligate anaerobe, it must possess mechanisms to recover from transient oxidative stress. Research has shown that thioredoxin (Trx) systems are nearly ubiquitous in anaerobic methanogens, enabling them to recover from oxidative stress and synchronize cellular processes . M. jannaschii possesses two Trx homologs, Trx1 and Trx2, which can reduce disulfide bonds formed during oxidative conditions .

Proteomic analyses have identified 152 M. jannaschii polypeptides as potential Trx1 targets, representing approximately 10% of the total open reading frames in the organism's genome . While mtrE was not specifically mentioned among these targets, other proteins involved in methanogenesis were identified. This suggests that oxidative stress recovery mechanisms are integrated with the regulation of methanogenic pathways.

The connection between oxidative stress recovery and methanogenesis is logical from a metabolic perspective. When experiencing oxidative stress, methanogens must pause methanogenesis (which requires strictly anaerobic conditions) and redirect resources toward detoxification and repair processes. Once the stress is alleviated, the methanogenic pathway, including the Mtr complex, must be reactivated in a coordinated manner.

How can structural knowledge of mtrE contribute to biomimetic energy systems?

The detailed structural understanding of the MtrABCDEFGH complex, including mtrE, provides valuable insights for developing biomimetic systems that couple chemical reactions with ion transport. The 2.08 Å cryo-EM structure revealing how methyl transfer is coupled to Na+ transport represents a natural example of energy transduction at the molecular level .

Biomimetic applications could include the development of artificial enzyme systems that couple chemical transformations with the generation of ion gradients. Such systems could potentially be incorporated into synthetic cells or membrane-based devices for energy production. The precise mechanism by which conformational changes in the MtrCDE components facilitate Na+ transport could inspire the design of molecular machines that perform similar functions.

Additionally, understanding how methanogens like M. jannaschii operate under extreme conditions (high temperature, high pressure) provides insights for designing robust biocatalysts. The thermostable nature of mtrE and other M. jannaschii proteins makes them potentially valuable templates for engineering enzymes that can function under harsh industrial conditions.

What are the implications of mtrE research for understanding similar systems in other domains of life?

While the MtrABCDEFGH complex is specific to methanogenic archaea, the principles of coupling methyl transfer reactions with ion transport have broader relevance. Similar coupling mechanisms exist in bacteria and eukaryotes, often involving different chemical reactions but employing analogous principles of energy conservation.

Comparative analyses of mtrE and similar membrane transporters from other organisms can reveal convergent evolution of energy-coupling mechanisms. For example, the alternating access mechanism proposed for Na+ transport by the MtrCDE components shows conceptual similarities to the mechanisms employed by other secondary transporters across all domains of life.

Research on mtrE also contributes to our fundamental understanding of membrane protein function and the molecular basis of ion transport. The structural insights gained from studying this archaeal system can inform models of how membrane proteins undergo conformational changes to facilitate directional movement of ions across biological membranes.

What controls are essential when studying recombinant mtrE function?

When designing experiments to study recombinant mtrE function, several critical controls must be implemented to ensure reliable results. First, appropriate negative controls should include preparations lacking the recombinant mtrE or containing catalytically inactive mutants with alterations in conserved residues. These controls help distinguish mtrE-specific effects from background activities or artifacts.

For reconstitution experiments, comparing proteoliposomes containing properly oriented mtrE versus randomly oriented preparations can reveal directional aspects of Na+ transport. Additionally, control experiments using ionophores that specifically dissipate Na+ gradients can confirm the nature of the transport process.

Temperature controls are especially important given M. jannaschii's thermophilic nature. Activity assays should be performed at temperatures that maintain protein stability while allowing for measurable activity rates. Comparative studies at different temperatures can provide insights into the thermodynamic properties of the system.

How can researchers address the challenge of maintaining anaerobic conditions when working with mtrE?

Working with proteins from strict anaerobes like M. jannaschii presents significant challenges related to oxygen sensitivity. The MtrABCDEFGH complex is particularly vulnerable due to its cobamide cofactor and redox-active components. Researchers must implement comprehensive anaerobic techniques throughout all experimental procedures.

All buffers and solutions should be degassed and supplemented with reducing agents such as dithiothreitol (DTT) or dithionite. Experiments have shown that DTT can effectively reduce Trx proteins from M. jannaschii , suggesting it may be suitable for maintaining reducing conditions for mtrE studies as well.

Specialized anaerobic chambers or glove boxes are essential for protein purification and activity assays. When direct spectrophotometric measurements are needed, sealed cuvettes with anaerobic solutions can be used. For longer experiments, oxygen-scavenging systems may be incorporated to maintain anaerobic conditions.

Researchers should also consider the stability of the protein under various reducing conditions. Comparative activity measurements under different redox potentials can reveal the optimal conditions for mtrE function and provide insights into its oxygen sensitivity.

How can computational approaches improve our understanding of mtrE function?

Computational approaches provide valuable tools for investigating aspects of mtrE function that are challenging to study experimentally. Molecular dynamics simulations can model the conformational changes in the MtrCDE components during Na+ transport, building upon the static structures obtained through cryo-EM . These simulations can test hypotheses about the alternating access mechanism and identify key residues involved in conformational transitions.

Integration of AlphaFold2 structural predictions with experimental data has already proven valuable for modeling functionally competent MtrA–MtrH and MtrA–MtrCDE subcomplexes . This approach can be extended to predict how specific mutations might affect protein-protein interactions within the complex.

Bioinformatic analyses comparing mtrE sequences across diverse methanogens can identify highly conserved residues likely to be functionally important. Correlation analysis of co-evolving residues can further reveal networks of amino acids that work together to enable protein function.

Quantum mechanical calculations can provide insights into the energetics of methyl transfer reactions and how they might couple with conformational changes in the protein. These approaches are particularly valuable for understanding the detailed mechanism of energy transduction at the atomic level.

What are the common pitfalls in interpreting experimental results related to mtrE function?

Interpreting experimental results for membrane proteins like mtrE presents several challenges that researchers must carefully navigate. One common pitfall is attributing observed activities to recombinant mtrE when they may result from contaminating proteins or non-specific effects. Rigorous controls and multiple purification steps are essential to ensure the specificity of the observed activities.

Another challenge relates to the artificial environments used for in vitro studies. The lipid composition, detergent choice, or reconstitution method can significantly impact protein function. Observed activities may differ from native function if the membrane environment doesn't adequately mimic the natural setting.

For complex multi-subunit systems like MtrABCDEFGH, incomplete assembly or improper stoichiometry can lead to misleading results. The trimeric arrangement of the complex adds another layer of complexity that must be considered when interpreting functional data.

The extreme growth conditions of M. jannaschii also complicate experimental design and interpretation. Activities measured under standard laboratory conditions may not reflect the true function of mtrE at high temperatures and pressures. Extrapolating from measurements made under accessible conditions to the native environment requires careful consideration of thermodynamic and kinetic principles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.