Recombinant Methanocaldococcus jannaschii Uncharacterized ABC transporter permease MJ0797 (MJ0797)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Uncharacterized ABC Transporter Permease MJ0797 (MJ0797)

Recombinant Methanocaldococcus jannaschii Uncharacterized ABC transporter permease MJ0797 (MJ0797) is a protein component of an ATP-binding cassette (ABC) transporter system found in the archaeon Methanocaldococcus jannaschii. ABC transporters are crucial for the transport of various substrates across cell membranes, utilizing the energy from ATP hydrolysis to drive the transport process . Despite its designation as "uncharacterized," MJ0797 is part of a broader family of ABC transporters that play significant roles in cellular processes, including nutrient uptake, drug resistance, and redox sensing .

Structure and Function of ABC Transporters

ABC transporters typically consist of two nucleotide-binding domains (NBDs) and two transmembrane domains (TMDs). The NBDs are responsible for ATP binding and hydrolysis, while the TMDs facilitate the movement of substrates across the membrane . The structure of ABC transporters involves a dimerization of the NBDs, which creates two ATP-binding sites at the interface between the Walker A motif of one subunit and the ABC signature motif of the other .

ComponentFunction
Nucleotide-Binding Domains (NBDs)ATP binding and hydrolysis
Transmembrane Domains (TMDs)Substrate transport across the membrane

Metabolic Context of Methanocaldococcus jannaschii

Methanocaldococcus jannaschii is a thermophilic archaeon with a well-characterized metabolic network. The organism's genome encodes for a variety of metabolic pathways, including those involved in amino acid biosynthesis and degradation, as well as cobalamin biosynthesis . The presence of ABC transporters in this organism suggests their involvement in maintaining cellular homeostasis and responding to environmental challenges.

Metabolic PathwayDescription
Amino Acid BiosynthesisEssential for protein synthesis
Amino Acid DegradationProvides energy and building blocks
Cobalamin BiosynthesisCrucial for various enzymatic reactions

Future Research Directions

Further research on MJ0797 could involve biochemical characterization to determine its substrate specificity and transport mechanism. Techniques such as X-ray crystallography, molecular dynamics simulations, and biochemical assays could provide detailed insights into its structure and function. Additionally, studying the regulation of MJ0797 expression and its interaction with other cellular components could reveal its physiological relevance in Methanocaldococcus jannaschii.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ0797; Uncharacterized ABC transporter permease MJ0797
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0797
Target Protein Sequence
MYFELAKRNLKRNLLRSILALLGIIIGVAAISSLGILGGGLKQGIMENLGSISNYIIVFP NYQNGYTSFDKRDIEKLRVLNCKVIPVYATSDFVYIKGKNRKAYANIFGIDKNDIKYLNL KVKVSDTSVAVDTFFSNVNDVNVGNQLEIKNISLRICGIYNSTFLFPDNSLILTAKTYRR FYGENNYNYSRIILYVKNINDIDKIKNETDKILNRKEKKCIIISLNSILEAINGVITKVS YFLMGIGAISLLVAGIGIGNVMLMSVVERTTEIGVMRSIGASKKDIIILFLYEALILGVI GSLIGAFLSLFFGYLIVHYLLKTSLSYYAIFYMIIGIIFGILTSLISALYPAYKASKLDP IKSLRNE
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0797

STRING: 243232.MJ_0797

Protein Families
ABC-4 integral membrane protein family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0797 and what organism does it come from?

MJ0797 is an uncharacterized ABC transporter permease protein from Methanocaldococcus jannaschii, a hyperthermophilic methanogenic archaeon. This organism is phylogenetically deeply rooted and serves as an important model for studies on archaea, hyperthermophilic metabolisms, and evolutionary biology . The protein is encoded by the MJ0797 gene in the M. jannaschii genome and belongs to the ATP-Binding Cassette (ABC) transporter superfamily, which contains both uptake and efflux transport systems .

The full protein consists of 367 amino acids and is typically expressed with affinity tags for purification purposes . M. jannaschii was one of the first archaeal genomes to be sequenced, and recent developments have made it genetically tractable, enabling more detailed in vivo studies of proteins like MJ0797 .

How does MJ0797 function within the ABC transporter system?

MJ0797 functions as the transmembrane permease component of an ABC transporter complex. ABC transporters undergo conformational changes between inward-facing (IF) and outward-facing (OF) states via chemo-mechanical coupling triggered by ATP binding .

The current prevailing model for ABC transporter mechanism is the Switch Model, in which:

  • The nucleotide binding domains dimerize upon binding two ATP molecules

  • This dimerization causes conformational changes in the transmembrane helices (including those of permease components like MJ0797)

  • These conformational changes facilitate substrate transport across the membrane

  • ATP hydrolysis leads to dissociation of the nucleotide binding domains, resetting the transporter for another cycle

An alternative model, the Constant Contact Model, has also been proposed where:

  • The nucleotide binding domains do not fully dissociate

  • ATP hydrolysis occurs alternately at each of the two active sites

  • One of the sites remains closed and contains an occluded nucleotide at all times

The ATP binding energy is converted into distortion energy of several transmembrane helices, including those in permease proteins like MJ0797, to facilitate the transport process .

What genetic approaches can be used to study MJ0797 function in M. jannaschii?

Recent advances have made M. jannaschii genetically tractable, enabling sophisticated analysis of proteins like MJ0797 directly in this hyperthermophile. Key methodological approaches include:

  • In-frame gene deletion: This method allows researchers to create MJ0797 knockout strains to study the phenotypic effects of protein loss and elucidate its physiological functions .

  • Homologous overexpression with affinity tags: This technique enables expression of MJ0797 with affinity tags (such as His-tag or FLAG-Twin Strep tag) directly in M. jannaschii for facile purification in its native state .

  • Solid medium cultivation: The ability to grow M. jannaschii on solid medium is crucial for clonal isolation in genetic studies. This can be achieved using Gelrite® gellan gum as a gelling agent, with added reducing agents such as cysteine (2 mM) or titanium (III) citrate (0.14 mM) .

  • Selectable markers: Mevinolin can be used as a selectable marker at concentrations of 10 μM for solid media and 20 μM for liquid media .

  • Cultivation conditions: For optimal growth and expression, M. jannaschii should be cultivated in anaerobic conditions at 80°C, with pressurized H₂ and CO₂ (80:20 v/v) to 3 × 10⁵ Pa .

The methods above allow for rigorous in vivo validation of MJ0797 function that was previously only possible through studies in surrogate systems like Methanococcus maripaludis or through in vitro reconstitution experiments.

What experimental approaches are optimal for purifying and characterizing MJ0797?

For successful purification and characterization of MJ0797, researchers should consider the following experimental approaches:

  • Expression systems:

    • Native expression in M. jannaschii using homologous overexpression systems with affinity tags

    • Heterologous expression in E. coli with appropriate tags (His-tag is commonly used)

  • Protein purification strategy:

    • Affinity chromatography using the expressed tag (His-tagged or FLAG-Twin Strep tagged MJ0797)

    • For thermostable proteins like MJ0797, a heat treatment step (60-70°C) can be used to remove heat-labile E. coli proteins when using heterologous expression

  • Structural characterization:

    • Mass spectrometry analysis for protein verification and post-translational modification identification

    • Proteolytic digestion (e.g., with thermolysin) followed by peptide analysis using systems like UltiMate™ 3000 RSLCnano coupled to mass spectrometry

    • Circular dichroism for secondary structure determination

    • X-ray crystallography or cryo-EM for high-resolution structural determination

  • Functional characterization:

    • ATPase activity assays to measure ATP hydrolysis rates

    • Reconstitution into liposomes for transport assays

    • Fluorescence-based binding assays to identify potential substrates

How does MJ0797 compare with related ABC transporters in terms of structure and mechanism?

MJ0797 belongs to the broader ABC transporter superfamily but has unique characteristics due to its origin in a hyperthermophilic archaeon. Comparative analysis reveals:

FeatureMJ0797 (M. jannaschii)Typical Bacterial ABC TransportersEukaryotic ABC Transporters
Thermal StabilityExtremely high (functions at 80°C)Moderate to highLow to moderate
Domain OrganizationSeparate permease componentOften fused domainsOften fused domains
Mechanism ModelBoth Switch and Constant Contact models may applyPredominantly Switch ModelVaries by subfamily
ATP BindingRelated to MJ0796 which forms ATP-bound dimersForms ATP-dependent dimersForms ATP-dependent dimers
Evolutionary PositionDeeply rooted, archaealDiverse bacterial variantsMore recent evolutionary adaptations

Both nucleotide binding domains contribute residues to each of the two nucleotide-binding sites in the dimer, creating a cooperative mechanism for ATP binding and hydrolysis that drives the conformational changes in the transmembrane domains including MJ0797 .

What are the optimal conditions for functional studies of MJ0797?

Due to the hyperthermophilic nature of M. jannaschii, special considerations are necessary when designing experiments to study MJ0797:

  • Temperature requirements:

    • In vivo studies should be conducted at 80°C in anaerobic conditions

    • In vitro studies may require specialized equipment capable of maintaining high temperatures during assays

  • Buffer compositions:

    • Use Tris-based buffers with 50% glycerol for protein storage

    • Consider the effect of temperature on buffer pH (Tris buffers have significant temperature-dependent pH changes)

  • Stability considerations:

    • Avoid repeated freezing and thawing of purified protein

    • Store working aliquots at 4°C for up to one week

    • For extended storage, conserve at -20°C or -80°C

  • Anaerobic requirements:

    • Maintain anaerobic conditions with H₂ and CO₂ (80:20 v/v)

    • Include reducing agents such as Na₂S (2 mM) in growth media

    • For solid media, additional reducing agents like cysteine (2 mM) or titanium (III) citrate (0.14 mM) are required

  • ATP hydrolysis assays:

    • Consider the effect of temperature on ATP hydrolysis rates

    • Include appropriate controls to account for non-enzymatic ATP hydrolysis at high temperatures

How can researchers overcome challenges in expressing and purifying functional MJ0797?

Researchers face several challenges when working with MJ0797 due to its hyperthermophilic origin and membrane protein nature. Key strategies to overcome these challenges include:

  • Expression optimization:

    • For native expression, develop a bioreactor-based cultivation of M. jannaschii under controlled conditions

    • For heterologous expression in E. coli, use specialized strains designed for membrane protein expression

    • Consider fusion tags that enhance membrane protein expression and folding

  • Solubilization and purification:

    • Test multiple detergents to identify optimal conditions for MJ0797 solubilization

    • Employ a systematic detergent screening approach (e.g., DDM, LMNG, digitonin)

    • Consider nanodiscs or amphipols for maintaining native-like lipid environment

  • Functional verification:

    • Develop assays that can be performed at high temperatures to verify protein functionality

    • Consider coupled enzyme assays for ATPase activity that can function at elevated temperatures

    • Verify protein folding using thermal stability assays such as differential scanning fluorimetry with temperature ranges appropriate for thermophilic proteins

  • Storage stability:

    • Add stabilizing agents such as glycerol (50%) to storage buffers

    • Aliquot purified protein to avoid repeated freeze-thaw cycles

    • Optimize buffer conditions based on experimental requirements

How should researchers interpret functional data for MJ0797 in the context of ABC transporter models?

When analyzing experimental data related to MJ0797 function, researchers should consider:

  • Mechanistic models:

    • Evaluate data in the context of both the Switch Model and the Constant Contact Model

    • Look for evidence of NBD dimerization and dissociation (supporting the Switch Model)

    • Alternatively, assess whether data supports constant contact between NBDs with alternating ATP hydrolysis

  • Conformational changes:

    • Analyze how ATP binding induces conformational transitions from inward-facing to outward-facing states

    • Consider how ATP binding energy converts to distortion energy in the transmembrane helices of MJ0797

  • Thermophilic adaptations:

    • Interpret kinetic data in the context of the hyperthermophilic environment (80°C)

    • Compare with homologous mesophilic transporters to identify thermostability-conferring features

  • Evolutionary context:

    • Consider the deeply rooted phylogenetic position of M. jannaschii when interpreting evolutionary implications

    • Assess whether MJ0797 represents an ancestral form of ABC transporters

What bioinformatic approaches can enhance our understanding of MJ0797?

Computational methods provide valuable insights into MJ0797 structure and function:

  • Sequence analysis:

    • Multiple sequence alignment with ABC transporters from diverse organisms to identify conserved regions

    • Identification of characteristic motifs associated with ATP binding and hydrolysis

    • Analysis of coevolution patterns to identify functionally coupled residues

  • Structural prediction:

    • Homology modeling based on available ABC transporter structures

    • De novo structure prediction using methods like AlphaFold

    • Molecular dynamics simulations to study conformational changes at high temperatures

  • Systems biology approaches:

    • Network analysis to identify potential functional partners of MJ0797

    • Genomic context analysis to identify genes frequently co-occurring with MJ0797 homologs

    • Transcriptomic analysis to identify conditions under which MJ0797 is highly expressed

  • Transport substrate prediction:

    • Docking simulations to identify potential substrates

    • Binding site analysis compared to ABC transporters with known substrates

    • Machine learning approaches trained on known ABC transporter-substrate pairs

What are the most promising avenues for further research on MJ0797?

Based on current knowledge gaps and recent methodological advances, the following research directions show particular promise:

  • High-resolution structural studies:

    • Cryo-EM analysis of MJ0797 in different conformational states during the transport cycle

    • Crystallography of MJ0797 in complex with its nucleotide binding domain partners

    • Time-resolved structural studies to capture intermediate conformations

  • Substrate identification:

    • High-throughput screening approaches to identify transported substrates

    • Metabolomic analysis comparing wild-type and MJ0797 knockout strains

    • Isotope labeling experiments to track potential substrates

  • Mechanistic investigations:

    • Single-molecule studies to distinguish between transport models

    • Engineering of cysteine residues for disulfide crosslinking to trap intermediate states

    • EPR spectroscopy to measure distances between domains during the transport cycle

  • Evolutionary studies:

    • Ancestral sequence reconstruction to investigate the evolution of ABC transporters

    • Horizontal gene transfer analysis to understand the distribution of MJ0797 homologs

    • Comparative genomics across the archaeal domain to identify conserved features

How can the genetic system for M. jannaschii be optimized for studying MJ0797?

The recently developed genetic system for M. jannaschii offers exciting possibilities for in vivo studies of MJ0797, which can be further optimized:

  • Inducible expression systems:

    • Develop temperature or chemical-inducible promoters for controlled expression

    • Create expression vectors with varying promoter strengths for titrating protein levels

  • Reporter systems:

    • Develop reporters functional at high temperatures for monitoring gene expression

    • Create fusion constructs to monitor protein localization and dynamics

  • CRISPR-Cas9 adaptation:

    • Optimize CRISPR-Cas9 for genome editing in hyperthermophilic conditions

    • Develop methods for multiplexed gene editing to study multiple components simultaneously

  • High-throughput screening:

    • Develop growth-based selection methods for identifying functional variants

    • Create reporter systems for monitoring transport activity in vivo

  • Synthetic biology approaches:

    • Engineer minimal ABC transporter systems to test specific hypotheses about MJ0797 function

    • Create hybrid transporters combining domains from different systems to investigate domain compatibility

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.