Recombinant Methanocaldococcus jannaschii Uncharacterized HTH-type transcriptional regulator MJ1553 (MJ1553)

Shipped with Ice Packs
In Stock

Description

Molecular and Production Characteristics

MJ1553 is expressed in E. coli as a recombinant protein with an N-terminal His-tag for purification. Key specifications include:

ParameterValueSource
Protein LengthFull-length (1–157 amino acids)
Molecular Weight~18 kDa (calculated)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C or -80°C (avoid repeated freeze-thaw cycles)

The protein’s amino acid sequence includes a conserved HTH motif (residues 28–47), critical for DNA binding in related regulators .

Functional Context and Regulatory Families

MJ1553 is annotated as part of the ArsR family of transcriptional regulators in archaea, which typically repress genes under non-inducing conditions . While no direct functional studies exist for MJ1553, homologs in methanogens (e.g., IMPDH VII in Methanothermobacter thermautotrophicus) regulate genes in response to hydrogen availability and energy status .

Regulatory FamilyProposed FunctionSource
ArsR FamilyRepression of stress-response or efflux pump genes
IMPDH VII HomologsSensing energy status via CBS domains; regulation of methanogenesis

Research Applications and Experimental Tools

Recombinant MJ1553 is available for biochemical assays:

ApplicationMethodologySource
DNA Binding AssaysElectrophoretic mobility shift assay (EMSA) to identify target promoters
Protein QuantificationELISA kits (e.g., CSB-CF691289MRU) for expression analysis
Structural StudiesX-ray crystallography or NMR to validate HTH-DNA interactions

Critical Knowledge Gaps

  1. Direct Functional Evidence: No studies confirm MJ1553’s role in regulating specific genes or pathways.

  2. DNA Target Specificity: The promoter regions it binds remain unidentified.

  3. Regulatory Partners: Potential interactions with RNA polymerase or other transcription factors are unexplored.

Comparative Analysis of HTH Regulators in Methanogens

RegulatorOrganismProposed FunctionSource
MJ1553M. jannaschiiHypothetical stress-response regulation
IMPDH VIIM. thermautotrophicusRepression of mcr operon under H₂ depletion
TetR Family ProteinsSulfolobus spp.DNA binding via HTH motifs

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge; please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ1553; Uncharacterized HTH-type transcriptional regulator MJ1553
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ1553
Target Protein Sequence
MKFLFSKTKIEILKKLNERNYTISELSKILGKSKSTISEHLNALYEMGLVDKENYSKWVY YKITNKGKKVLENLEALILMVSSIFALIGLWIYYIFKQIKYQAREVVLSKTVVERGIYTT YKGSTTFQKEPLFLIFLIISTFLIIFIVYLVYKIIRR
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_1553

STRING: 243232.MJ_1553

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant in scientific research?

Methanocaldococcus jannaschii is the first known hyperthermophilic methanogen and the first hyperthermophilic chemolithotrophic organism isolated from a deep-sea hydrothermal vent. Its significance lies in its phylogenetically deep-rooted position in the archaeal domain and its representation of one of the most ancient respiratory metabolisms on Earth, estimated to have developed around 3.49 billion years ago . M. jannaschii derives energy solely from hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O) and can generate an entire cell from inorganic nutrients, representing a minimal requirement for life to exist independent of other living systems . The environmental conditions of its natural habitat mimic those of early Earth, making it valuable for understanding early life and evolution .

What is MJ1553 and what is its predicted function?

MJ1553 is an uncharacterized HTH-type transcriptional regulator from Methanocaldococcus jannaschii . Based on its structural classification, it likely functions as a DNA-binding protein involved in regulating gene expression. HTH-type transcriptional regulators typically bind to specific DNA sequences to either activate or repress the transcription of target genes. The exact genes regulated by MJ1553 and the specific physiological processes it controls remain unknown, hence its "uncharacterized" status. Comparative analyses with similar transcriptional regulators suggest it may have a dual function: DNA-binding through its N-terminal domain and ligand-binding through its C-terminal domain, potentially allowing it to respond to specific cellular or environmental signals .

How does MJ1553 compare to other HTH-type transcriptional regulators?

While specific comparative data for MJ1553 is limited, we can infer similarities based on other HTH-type transcriptional regulators described in the search results:

  • DNA-binding domain: Like TetR, QacR, and other HTH-type regulators, MJ1553 likely has a conserved HTH motif in its N-terminal domain. Based on structural studies of similar proteins, there may be variations in the length of the recognition helix and the number of residues in the turn motif, which can affect DNA-binding specificity .

  • Ligand-binding domain: By analogy with TetR and QacR, MJ1553 may contain a tunnel-like ligand-binding pocket lined with hydrophobic residues. In similar proteins, this tunnel is approximately 20Å in length with a variable diameter (4-6Å) and can accommodate small molecule ligands that modulate the protein's activity .

  • Sequence conservation: HTH-type transcriptional regulators typically show higher sequence conservation in their DNA-binding domains (particularly the HTH motif) compared to their ligand-binding domains. This pattern reflects functional constraints on DNA recognition versus the diverse ligands these proteins have evolved to bind .

A notable feature observed in similar HTH-type regulators is the occurrence of strictly conserved residues (such as Ala15, Phe47, and Glu52 in the example from search result), which may have structural or functional significance .

What expression systems are optimal for producing recombinant MJ1553?

Based on the search results, recombinant MJ1553 has been successfully expressed in E. coli with an N-terminal His tag . This approach appears effective for producing the full-length protein (1-157 amino acids).

When working with proteins from hyperthermophiles like M. jannaschii, researchers should consider:

  • Codon optimization: The genetic code usage differs between archaeal and bacterial systems. Codon optimization for E. coli can improve expression yields.

  • Expression temperature: Since M. jannaschii is a hyperthermophile (optimal growth at ~85°C), its proteins may not fold properly at standard E. coli growth temperatures. Testing various induction temperatures (often lower than standard, e.g., 18-25°C) can help improve soluble protein yield.

  • Solubility tags: Besides His tags for purification, solubility-enhancing tags such as SUMO, MBP, or GST might be beneficial if expression results in inclusion bodies.

  • Expression strains: E. coli strains designed for expressing proteins with rare codons (like Rosetta) or those enhancing disulfide bond formation may improve yields depending on the protein characteristics.

  • Media composition and induction conditions: Testing different media (LB, TB, auto-induction) and IPTG concentrations can optimize expression.

What purification strategies are effective for MJ1553?

According to the search results, recombinant MJ1553 has been produced with an N-terminal His tag, suggesting immobilized metal affinity chromatography (IMAC) as the primary purification method . A comprehensive purification strategy might include:

  • Initial IMAC purification: Using Ni-NTA or similar resins to capture the His-tagged protein.

  • Buffer optimization: Since MJ1553 comes from a hyperthermophilic organism, including stabilizing agents like glycerol (as noted in search result, where 6% trehalose was used) can help maintain protein stability .

  • Secondary purification: Size exclusion chromatography to remove aggregates and ensure homogeneity, particularly important for structural studies.

  • Consideration of detergents: If the C-terminal domain of MJ1553 contains the hydrophobic ligand-binding pocket typical of HTH-type regulators, mild detergents might improve stability in solution.

  • Heat treatment: As a protein from a hyperthermophile, MJ1553 might remain stable at temperatures that denature most E. coli proteins, potentially allowing for a heat purification step (e.g., 60-70°C incubation) to remove host proteins.

The search results indicate that purified MJ1553 should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, and can be lyophilized for long-term storage . Working aliquots can be kept at 4°C for up to a week, with long-term storage at -20°C/-80°C, preferably with 5-50% glycerol to prevent freeze-thaw damage .

How can the DNA-binding activity of MJ1553 be assessed experimentally?

Several complementary approaches can be used to characterize the DNA-binding activity of MJ1553:

  • Electrophoretic Mobility Shift Assay (EMSA): This fundamental technique can determine if MJ1553 binds DNA and assess binding affinity. Initial experiments might use random DNA sequences, followed by more targeted approaches once binding is confirmed.

  • DNase I footprinting: This method can identify specific DNA sequences protected by MJ1553 binding, helping to define its recognition motif.

  • Systematic Evolution of Ligands by Exponential Enrichment (SELEX): This technique can identify preferred binding sequences from a random pool of oligonucleotides, useful when the natural target is unknown.

  • Chromatin Immunoprecipitation followed by sequencing (ChIP-seq): If antibodies against MJ1553 are available, this method can identify binding sites genome-wide in vivo, though applying this to M. jannaschii would require special considerations due to its growth conditions.

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI): These techniques provide real-time binding kinetics and can determine association/dissociation constants.

  • Fluorescence Anisotropy: Using fluorescently labeled DNA fragments to measure binding by changes in rotational diffusion upon protein binding.

  • X-ray crystallography or Cryo-EM of MJ1553-DNA complexes: These structural approaches can provide atomic-level details of binding interactions, similar to the studies of TetR and QacR mentioned in search result .

When designing these experiments, researchers should consider the extreme growth conditions of M. jannaschii (high temperature, high pressure) and how these might affect protein-DNA interactions.

What methods can be used to identify potential ligands for MJ1553?

Based on structural similarities with other HTH-type transcriptional regulators like TetR and QacR, MJ1553 likely has a ligand-binding domain. To identify potential ligands:

  • Structural analysis and virtual screening: Using the solved or modeled structure of MJ1553, computational docking studies can screen compound libraries for potential binding partners. The search results suggest that the ligand-binding domain of similar proteins forms a tunnel-like region approximately 20Å in length with a variable 4-6Å diameter, predominantly lined with hydrophobic residues .

  • Thermal shift assays (Differential Scanning Fluorimetry): These can identify compounds that stabilize the protein upon binding, indicating a potential ligand.

  • Isothermal Titration Calorimetry (ITC): This provides direct measurement of binding thermodynamics between the protein and potential ligands.

  • Fluorescence-based assays: If MJ1553 contains tryptophan residues near the binding pocket (search result mentions a conserved Trp131 in similar proteins), intrinsic fluorescence changes upon ligand binding can be monitored .

  • Co-crystallization attempts: Crystallizing MJ1553 in the presence of potential ligands might capture the bound state, providing structural confirmation.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: For small proteins or domains, NMR can detect ligand binding through chemical shift perturbations.

  • Metabolite profiling from M. jannaschii: Analyzing the natural metabolites of M. jannaschii under different growth conditions might identify candidate ligands.

Since M. jannaschii is a methanogen growing in extreme conditions, potential physiological ligands might include intermediates of the methanogenesis pathway, redox sensors, or small molecules related to stress response .

How can researchers address the challenges of studying a hyperthermophilic protein like MJ1553?

Studying MJ1553 from the hyperthermophile M. jannaschii presents several unique challenges that require specialized approaches:

  • Temperature considerations:

    • Functional assays should ideally be performed at or near the organism's growth temperature (~85°C)

    • Standard laboratory equipment and reagents may not be compatible with high temperatures

    • Solution: Use thermostable reagents, pressure-resistant vessels, and appropriate controls to account for temperature effects

  • Protein stability at mesophilic temperatures:

    • While hyperthermophilic proteins are stable at high temperatures, they may unfold or aggregate at lower temperatures

    • Solution: Include stabilizing agents like trehalose or glycerol in buffers; store in small aliquots to minimize freeze-thaw cycles

  • Reconstituting physiological conditions:

    • M. jannaschii's natural environment includes high pressure and specific salt concentrations

    • Solution: Consider using bioreactor systems that can mimic environmental parameters, as mentioned in search result

  • Lack of genetic system:

    • Search result mentions development of a genetic system for M. jannaschii, but working with this organism remains challenging

    • Solution: Consider using surrogate systems like Methanococcus maripaludis (mentioned in search result) for in vivo functional studies, while validating results in M. jannaschii when possible

  • Structural studies:

    • Crystallization conditions for hyperthermophilic proteins may differ from mesophilic proteins

    • Solution: Screen crystallization conditions at various temperatures; consider in situ high-temperature crystallization for native state

  • Enzymatic assays:

    • Standard coupling enzymes used in assays may not function at high temperatures

    • Solution: Develop direct measurement methods or use thermostable coupling enzymes

A methodological approach might involve initial characterization at standard laboratory temperatures with appropriate controls, followed by validation under more physiologically relevant conditions.

What approaches can be used to identify the natural DNA targets of MJ1553?

Identifying the natural DNA targets of an uncharacterized transcriptional regulator like MJ1553 requires a multi-faceted approach:

  • Comparative genomics:

    • Analyze the genomic context of MJ1553 in M. jannaschii

    • Identify potentially co-regulated genes or operons

    • Compare with similar regulators in related species to identify conserved regulatory patterns

  • Transcriptomic analysis:

    • Perform RNA-seq under various growth conditions to identify genes with expression patterns that correlate with MJ1553

    • If possible, create MJ1553 overexpression or knockout strains and analyze transcriptome changes

  • Chromatin Immunoprecipitation (ChIP) approaches:

    • Develop antibodies against MJ1553 or use tagged versions

    • Perform ChIP-seq to directly identify genome-wide binding sites

    • Adapt protocols for high-temperature organisms

  • In vitro binding site selection:

    • Use SELEX or similar methods to identify DNA sequences with high affinity for MJ1553

    • Validate these sequences in the M. jannaschii genome

  • Bioinformatic predictions:

    • Based on binding motifs identified through experimental methods, scan the genome for potential binding sites

    • Use machine learning approaches trained on known HTH-protein binding sites

  • Reporter gene assays:

    • Test candidate target promoters using reporter systems

    • May require adaptation to function in thermophilic conditions or use of surrogate hosts

  • Biological network analysis:

    • Integrate transcriptomic, proteomic, and metabolomic data to identify regulatory networks

    • Position MJ1553 within these networks based on binding site data

For hyperthermophiles like M. jannaschii, these approaches may require significant adaptation of standard protocols to account for high temperature, pressure, and other environmental factors unique to this organism .

How can contradictory data about MJ1553 function be reconciled in research?

Managing contradictory data is an inherent challenge in biological research, particularly for uncharacterized proteins like MJ1553. Based on search result which mentions "rule modeling for contradictory data," several approaches can be applied :

  • Systematic analysis of experimental conditions:

    • Create a comprehensive table documenting all experimental variables across contradictory studies

    • Identify critical differences in protein preparation, buffer conditions, temperature, pH, etc.

    • Test whether these variables explain the contradictions

  • Statistical approaches:

    • Apply meta-analysis techniques to quantitatively assess contradictory results

    • Use Bayesian methods to update probability estimates as new data emerges

    • Develop consensus models that weight evidence based on methodological rigor

  • Computational modeling:

    • Use structural models to predict how different experimental conditions might affect protein behavior

    • Simulate protein-DNA and protein-ligand interactions under varying conditions

    • Identify potential conformational states that might explain divergent results

  • Multi-laboratory validation:

    • Establish standardized protocols across research groups

    • Perform blind replication studies of key experiments

    • Create shared resources (plasmids, purified proteins, antibodies) to minimize technical variation

  • Consider biological heterogeneity:

    • Investigate whether MJ1553 might have multiple functions depending on cellular context

    • Examine whether post-translational modifications alter its function

    • Assess whether it interacts with different partners under different conditions

  • Rule-based modeling approaches:

    • Develop formal rule systems that can accommodate apparently contradictory data

    • Use machine learning to identify patterns in complex datasets

    • Create probabilistic models that predict protein behavior under specific conditions

A methodological framework for reconciling contradictions might include:

  • Data collection and standardization

  • Identification of critical variables

  • Hypothesis generation to explain contradictions

  • Targeted experiments to test these hypotheses

  • Model refinement based on new data

  • Development of a unified understanding that accommodates apparent contradictions

What computational methods are useful for predicting MJ1553 interactions?

Several computational approaches can help predict interactions of MJ1553 with DNA, ligands, and other proteins:

  • For DNA-binding predictions:

    • Position Weight Matrix (PWM) models based on known HTH-DNA interactions

    • Support Vector Machines (SVM) trained on DNA-binding protein features

    • Deep learning approaches like Convolutional Neural Networks (CNNs) applied to protein-DNA binding

    • Molecular dynamics simulations of MJ1553-DNA complexes

    • Homology modeling based on structurally characterized HTH-DNA complexes like those mentioned in the search results

  • For ligand-binding predictions:

    • Molecular docking of candidate ligands to the putative binding pocket

    • Pharmacophore modeling based on known ligands of related HTH-type regulators

    • Virtual screening of metabolite libraries against the binding pocket

    • Quantum mechanics calculations to assess binding energetics

    • Machine learning methods trained on known protein-ligand interactions

  • For protein-protein interaction predictions:

    • Sequence-based methods like co-evolution analysis

    • Structure-based protein-protein docking

    • Interolog mapping (extrapolating from known interactions in related proteins)

    • Network-based predictions incorporating known protein interaction networks

    • Text mining of scientific literature for potential interaction partners

  • Integrative approaches:

    • Combining genomic context, co-expression data, and structural predictions

    • Multi-scale modeling linking molecular interactions to system-level behavior

    • Bayesian networks incorporating multiple data types

    • Combined molecular dynamics and continuum electrostatics calculations

When applying these methods to MJ1553, it's important to account for the thermophilic nature of M. jannaschii, as standard parameters optimized for mesophilic proteins may not accurately model interactions under high-temperature conditions .

How might understanding MJ1553 contribute to our knowledge of archaeal gene regulation?

Studying MJ1553 has several potential contributions to our understanding of archaeal gene regulation:

  • Evolutionary insights:

    • M. jannaschii is phylogenetically deeply rooted, as mentioned in search result

    • Understanding its transcriptional regulators can provide insights into the evolution of gene regulation

    • Comparative analysis with bacterial and eukaryotic transcription factors may illuminate convergent or divergent evolutionary pathways

  • Extremophile adaptation mechanisms:

    • Reveals how gene regulatory networks function under extreme conditions (high temperature, pressure)

    • Provides insights into strategies for maintaining DNA-protein interactions at temperatures where DNA typically denatures

    • May uncover unique regulatory mechanisms adapted to hyperthermophilic environments

  • Methanogenesis regulation:

    • If MJ1553 regulates genes involved in methanogenesis, it would contribute to understanding the regulation of one of Earth's oldest metabolic pathways

    • Could reveal regulatory circuits controlling this environmentally significant process

  • Archaeal-specific regulatory mechanisms:

    • Might reveal regulatory strategies unique to Archaea, distinct from bacterial or eukaryotic systems

    • Could identify novel DNA recognition motifs or regulatory principles

  • Minimal regulatory systems:

    • M. jannaschii represents a minimal requirement for life, as noted in search result

    • Studying its regulators could reveal essential, conserved regulatory principles

  • Stress response mechanisms:

    • May illuminate how gene expression is modulated in response to environmental stressors in extremophiles

    • Could reveal unique signaling molecules or regulatory circuits

Understanding MJ1553 would add to the growing body of knowledge about archaeal gene regulation, which remains less characterized than bacterial or eukaryotic systems despite the ecological and evolutionary significance of Archaea.

What biotechnological applications might be developed from MJ1553 research?

Research on MJ1553 could lead to several biotechnological applications:

  • Thermostable molecular tools:

    • Development of heat-stable DNA-binding proteins for use in high-temperature PCR or other molecular biology applications

    • Creation of thermostable biosensors based on the ligand-binding capabilities of MJ1553

  • Synthetic biology applications:

    • Design of thermostable genetic switches for synthetic biology systems

    • Creation of gene regulatory circuits that function at high temperatures

    • Development of expression systems for thermophilic hosts

  • Protein engineering platforms:

    • Using insights from MJ1553 structure to engineer proteins with enhanced thermostability

    • Creating chimeric transcription factors with novel specificities but thermophilic properties

  • Environmental applications:

    • If MJ1553 regulates methanogenesis genes, insights could lead to biotechnological approaches for methane production or consumption

    • Development of biosensors for environmental monitoring in extreme environments

  • Structural biology advances:

    • The ligand-binding pocket architecture of HTH-type regulators can inform drug design

    • Understanding protein stability at high temperatures has implications for industrial enzyme development

  • Biofuel production:

    • If involved in regulating archaeal metabolism, findings could inform development of high-temperature bioprocesses for fuel production

    • Could lead to engineered microbial systems for enhanced biofuel yield under extreme conditions

The extreme stability and unique properties of proteins from hyperthermophiles like M. jannaschii make them valuable starting points for biotechnological applications requiring function under harsh conditions.

How does the study of MJ1553 contribute to understanding evolutionary relationships in transcriptional regulators?

Studying MJ1553 provides several avenues for understanding the evolution of transcriptional regulators:

This evolutionary perspective can help establish fundamental principles of transcriptional regulation that transcend specific lineages and illuminate how complex regulatory systems evolved from simpler ancestral forms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.