Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0018 (MJ0018)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment accordingly.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0018; Uncharacterized protein MJ0018
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-524
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0018
Target Protein Sequence
MIFKKRKGQLTLEFILLILGMTVVGIVITMGLVEKSPIFIGDKPLEVKKETMGLFINESK FNLTVENTTISNLGNNNTESNNSNNETGGGYLYIRVSGSSKGLITKDLIVSGDAKDVSGD ISKTINSKCVEENAIGEVYGDIYLEGSANYKLGNLLCINKFQTYLTGSGSLKVYVPYIQE FIIRDKNSGESQIGGSVSLTVGNTNINRFYVEKITGGAKVKFKDFAINTFETNSGNFGGG AETVFENGRISTMKLGDIVSGGNVKFKNVNIGNMIINNMIGSPTFELSNSTINNMKINKL IGSPKILVEDSSIINSLETDQLGGSDIEVKDGSIIKEITIHGSTGTNGKIFVGYGGKVEK LFVEGNINSRIDLKGFSGLIDVSIGNIAGGGKLYVDNVIGNSISTGIIGNNKGLEIEDSS LSVVNIEGVSNSGSAFIKNTLIYQLKINSLPDWGSDMTLNKVNITKLSINEIRNGKLTIK NSEIGELHITKISGKGKIIVKKSYVNGKYYKKLVIKKSNYKKWS
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0018

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are recommended for recombinant MJ0018 production?

The recombinant MJ0018 protein is typically produced in E. coli expression systems, as evidenced by commercial preparations . For optimal expression of archaeal proteins like MJ0018, the following methodological approach is recommended:

ParameterRecommended ConditionRationale
Host strainBL21(DE3), Rosetta(DE3)Handles codon bias issues common with archaeal genes
Expression vectorpET with T7 promoterStrong, inducible expression system
Induction temperature16-20°CSlower expression improves folding despite protein's thermophilic origin
IPTG concentration0.1-0.5 mMModerate induction prevents inclusion body formation
Induction duration16-24 hoursExtended period at lower temperature improves yield
MediumTB or 2xYT with appropriate antibioticsRich media improves biomass and protein yield
Solubility enhancementsMBP/SUMO fusion, chaperone co-expressionImproves soluble fraction yield

The expressed protein should be verified by SDS-PAGE and Western blotting, with purification typically performed via affinity chromatography using the N-terminal His-tag .

What computational approaches can predict potential functions of MJ0018?

Multiple computational strategies should be employed in parallel to generate hypotheses about MJ0018 function:

  • Sequence-based analysis:

    • BLAST/PSI-BLAST searches against protein databases

    • Analysis using domain prediction tools (Pfam, SMART, InterPro)

    • Identification of conserved sequence motifs

  • Structure prediction and analysis:

    • Use AlphaFold2 or RoseTTAFold to generate 3D structural models

    • Perform structural similarity searches using DALI or TM-align

    • Identify potential binding pockets or catalytic sites

  • Genomic context analysis:

    • Examine neighboring genes in the M. jannaschii genome

    • Identify potential operons that might suggest functional relationships

    • Compare with syntenic regions in related archaeal genomes

  • Phylogenetic profiling:

    • Identify co-occurring genes across species that may function together

    • Determine evolutionary conservation patterns

  • Integrated approaches:

    • Use tools like STRING that combine multiple evidence types

    • Apply machine learning methods trained on archaeal proteins

The initial analysis of MJ0018's sequence suggests it may contain a transmembrane region, which could indicate membrane association or transport functions . This prediction should be verified experimentally through the methods described in subsequent questions.

What experimental strategies are most effective for determining MJ0018 function?

A comprehensive experimental approach to determining MJ0018 function should combine multiple methodologies:

ApproachSpecific TechniquesExpected Outcomes
Genetic manipulationKnockout/knockdown studies if genetic tools available; Heterologous expressionPhenotypic changes indicating biological role
ProteomicsAffinity purification-mass spectrometry (AP-MS); Crosslinking MS (XL-MS); Proximity labelingIdentification of interaction partners
TranscriptomicsRNA-seq comparing wild-type and MJ0018 mutantsAffected pathways and regulatory networks
Biochemical screeningSystematic testing of enzymatic activities based on structural predictionsDirect functional characterization
Cellular localizationImmunolocalization; Fractionation studies; Fusion with thermostable fluorescent proteinsSubcellular context for function
MetabolomicsComparative profiling between wild-type and mutantsAffected metabolic pathways
Environmental responseExpression analysis under various conditionsCorrelation with specific stresses or growth phases

The experimental design must account for M. jannaschii's extreme growth conditions, particularly high temperature (85°C) and anaerobic environment . This may require specialized equipment and modified protocols, particularly for in vivo studies.

For thermophilic proteins like MJ0018, activity assays should be performed at elevated temperatures that mimic the native environment, while considering potential partnerships with other M. jannaschii proteins that may be required for function .

How can structural characteristics of MJ0018 be determined under conditions mimicking its native environment?

Determining the structure of a hyperthermophilic protein like MJ0018 under native-like conditions requires specialized approaches:

  • High-temperature X-ray crystallography:

    • Crystallize MJ0018 at room temperature but collect diffraction data at elevated temperatures

    • Use specialized equipment for in situ temperature control during data collection

    • Compare structures obtained at different temperatures to identify conformational changes

  • NMR spectroscopy with temperature variation:

    • Produce isotope-labeled protein (15N, 13C, 2H) in E. coli

    • Record spectra at multiple temperatures (25°C, 50°C, 75°C)

    • Track chemical shift changes to identify temperature-dependent conformational changes

    • May require domain-based approach due to MJ0018's large size (524 amino acids)

  • Biophysical characterization across temperature ranges:

    • Circular dichroism (CD) to monitor secondary structure changes

    • Differential scanning calorimetry (DSC) to determine thermal stability profiles

    • Intrinsic fluorescence spectroscopy to track tertiary structure changes

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) at various temperatures

  • Cryo-EM as an alternative approach:

    • Single-particle cryo-EM to determine structure without crystallization

    • Potentially visualize different conformational states

For a hyperthermophile like M. jannaschii, which grows optimally at 85°C, structural studies should ideally include analysis at physiologically relevant temperatures to capture the protein's native conformation .

What challenges exist in characterizing protein-protein interactions involving MJ0018 in extremophilic conditions?

Studying protein-protein interactions involving proteins from hyperthermophiles presents several unique challenges:

  • Temperature-dependent interaction dynamics:

    • Interactions stable at 85°C may dissociate at standard laboratory temperatures

    • Binding affinity and kinetics likely optimized for high-temperature environments

    • Experimental setup must accommodate high-temperature conditions

  • Buffer and solution considerations:

    • Standard buffers may have different properties at elevated temperatures

    • pH changes with temperature affect protein surface charges

    • Solubility of gases (particularly important for anaerobic M. jannaschii) varies with temperature

  • Technical limitations:

    • Many interaction detection methods aren't designed for high temperatures

    • Specialized equipment required for maintaining anaerobic conditions

    • Protein stability during extended experiments at elevated temperatures

  • Methodological adaptations required:

    • Two-hybrid systems: Need thermophilic versions or temperature-resistant reporters

    • Pull-down assays: Must be performed at elevated temperatures to capture native interactions

    • Crosslinking approaches: Chemistry may differ at high temperatures

    • Calorimetry (ITC): Requires instruments capable of high-temperature operation

  • Computational prediction challenges:

    • Limited training data for interaction prediction algorithms in extremophiles

    • Different physicochemical principles may govern interactions at extreme temperatures

A combined approach using in vitro reconstitution of interactions at high temperatures, followed by structural characterization of complexes and validation in vivo (if genetic tools are available) would provide the most comprehensive characterization of MJ0018's interaction network .

How does the thermal stability of MJ0018 compare to mesophilic homologs, and what structural features contribute to this stability?

Comparing thermal stability between MJ0018 and potential mesophilic homologs requires both computational and experimental approaches:

  • Comparative stability analysis:

    • Thermal denaturation studies (CD, DSC, thermal shift assays) comparing MJ0018 with identified homologs

    • Measure unfolding temperatures (Tm) and thermodynamic parameters

    • Expected result: MJ0018 likely shows significantly higher Tm values (potentially >90°C)

  • Structural features contributing to thermostability:

    • Increased number of salt bridges and ion pairs

    • Enhanced hydrophobic core packing

    • Reduced surface loop length and flexibility

    • Higher proportion of charged residues on protein surface

    • Decreased thermolabile amino acids (Asn, Gln, Cys, Met)

    • Increased proline content in loops

    • More extensive hydrogen bonding networks

  • Computational analysis approaches:

    • Molecular dynamics simulations at various temperatures

    • Analysis of sequence composition differences between MJ0018 and mesophilic homologs

    • Calculation of electrostatic interaction networks

  • Experimental validation strategies:

    • Structure determination at multiple temperatures

    • Site-directed mutagenesis targeting predicted stabilizing features

    • Chimeric protein construction combining domains from MJ0018 and mesophilic homologs

M. jannaschii, growing optimally at 85°C, produces proteins with exceptional thermal stability . Understanding the specific stabilizing features in MJ0018 could provide insights not only into archaeal protein evolution but also inform protein engineering efforts for creating thermostable variants of industrial enzymes.

What potential roles might post-translational modifications play in MJ0018 function under extremophilic conditions?

Post-translational modifications (PTMs) in archaeal proteins, particularly from extremophiles like M. jannaschii, remain understudied but may be critical for function:

  • Types of archaeal PTMs relevant to MJ0018:

    • Methylation: Common in archaea, particularly on lysine residues

    • Acetylation: Observed in various archaeal proteins

    • Phosphorylation: Less prevalent than in eukaryotes but present

    • Glycosylation: N-linked glycosylation occurs in archaea

    • SAMPylation: Small archaeal modifier proteins (similar to ubiquitination)

  • Potential functional implications:

    • Thermostability enhancement: Certain modifications may increase resistance to thermal denaturation

    • Regulation of membrane association: If MJ0018 is membrane-associated, PTMs might modulate this interaction

    • Protein-protein interaction regulation: PTMs could create or mask interaction surfaces

    • Activity modulation: If MJ0018 has enzymatic activity, PTMs might regulate it

    • Protection against environmental stress: Modifications may shield sensitive residues

  • Experimental detection approaches:

    • Mass spectrometry-based proteomics optimized for archaeal proteins

    • PTM-specific enrichment strategies before MS analysis

    • Site-directed mutagenesis of potentially modified residues

    • PTM-specific antibodies (if available)

  • Special considerations for extremophiles:

    • PTMs might be more stable at high temperatures

    • Different enzymes may catalyze modifications in extremophiles

    • Novel, uncharacterized modifications might exist

Studying PTMs in MJ0018 requires careful sample preparation that preserves modifications and avoids artifacts. Native purification from M. jannaschii cultures grown under various conditions would provide the most authentic view of the protein's modification state .

How can gene editing tools be optimized for functional genomics studies of MJ0018 in M. jannaschii?

Recent developments have made genetic manipulation of methanogens, including M. jannaschii, more feasible. Optimizing these systems for MJ0018 functional studies requires:

  • Current genetic systems for M. jannaschii:

    • The development of genetic systems for M. jannaschii has been reported, enabling studies of evolutionary deeply rooted hyperthermophilic methanoarchaea

    • These systems allow for gene manipulation and expression studies in the native organism

  • CRISPR-Cas9 adaptations for hyperthermophiles:

    • Selection of thermostable Cas9 variants (e.g., from Geobacillus stearothermophilus)

    • Design of guide RNAs with increased thermal stability

    • Temperature-optimized transformation protocols for M. jannaschii

    • Selective markers functional at high temperatures

    • Validation of editing efficiency under optimal growth conditions (85°C)

  • Shuttle vector development:

    • Construction of E. coli-M. jannaschii shuttle vectors

    • Incorporation of origins of replication functional in M. jannaschii

    • Selection markers effective in anaerobic, high-temperature conditions

    • Inducible promoter systems for controlled expression

  • Expression strategies for MJ0018 variants:

    • Native promoter preservation for physiological expression levels

    • Epitope tagging approaches compatible with archaeal systems

    • Complementation studies with mutant versions of MJ0018

    • Reporter gene fusions optimized for hyperthermophilic growth

  • Phenotypic analysis considerations:

    • High-throughput growth assessment under various conditions

    • Techniques for studying gene knockouts/knockdowns in bioreactor settings

    • Methods for analyzing cell morphology and physiology at high temperatures

The genetic manipulation of M. jannaschii allows in vivo validation of biosynthesis pathways and functional characterization of uncharacterized proteins like MJ0018, potentially revealing its role in methanogenesis or adaptation to extreme environments .

What implications would the functional characterization of MJ0018 have for understanding early evolution of life and archaea?

The functional characterization of MJ0018 could provide significant insights into fundamental questions about early life and archaeal evolution:

  • Evolutionary significance of M. jannaschii:

    • M. jannaschii is a phylogenetically deeply rooted archaeon, making it valuable for studying early cellular evolution

    • It derives energy solely from hydrogenotrophic methanogenesis, considered one of the most ancient respiratory metabolisms, estimated to have developed 3.49 billion years ago

    • The organism generates entire cells from inorganic nutrients, representing a minimal requirement for life independent of other systems

  • Potential insights from MJ0018 characterization:

    • Identification of novel archaeal-specific metabolic pathways

    • Discovery of adaptations to extreme environments resembling early Earth

    • Understanding of unique protein structures and functions in early-branching archaea

    • Elucidation of potential ancient protein functions conserved across domains of life

  • Comparative genomics implications:

    • Understanding archaeal-specific genes with no bacterial or eukaryotic homologs

    • Identification of protein domains that may have been present in the last universal common ancestor (LUCA)

    • Insights into protein adaptation to high-temperature, high-pressure environments similar to those of early Earth

  • Biotechnological applications:

    • Novel thermostable enzymes for industrial processes

    • Insights for biogas/methane production at high temperatures

    • Models for protein engineering in extreme conditions

M. jannaschii was the first archaeon to have its genome sequenced, which revealed that approximately 60% of its genes (including MJ0018) had no predicted function at that time . Characterizing these uncharacterized proteins provides a unique opportunity to discover novel biological functions potentially representing ancient cellular processes that emerged during early evolution.

What are the optimal conditions and methodologies for studying MJ0018 interactions with membranes?

If MJ0018 is indeed membrane-associated as its sequence suggests, specialized approaches are needed to study its membrane interactions:

  • Biophysical characterization of membrane interactions:

    • Liposome binding assays using archaeal lipid compositions

    • Surface plasmon resonance with immobilized membrane mimetics

    • Fluorescence spectroscopy to monitor membrane insertion

    • Neutron reflectometry to determine orientation in membranes

  • Structural studies of membrane-associated forms:

    • Solid-state NMR with isotope-labeled protein in lipid bilayers

    • Cryo-EM of membrane-reconstituted MJ0018

    • Site-directed spin labeling and EPR spectroscopy

  • Computational approaches:

    • Molecular dynamics simulations of MJ0018 with archaeal membrane models

    • Prediction of transmembrane regions and topology

    • Identification of potential lipid-binding sites

  • Specialized considerations for archaeal membranes:

    • Archaeal membranes contain unique ether-linked lipids rather than ester-linked lipids

    • High-temperature stability requires special membrane compositions

    • Membrane fluidity differs from bacterial/eukaryotic systems

  • Experimental temperatures:

    • Studies should be conducted at temperatures relevant to M. jannaschii's growth (75-90°C)

    • Comparison between room temperature and elevated temperature behavior

  • Cellular localization validation:

    • Membrane fractionation of native M. jannaschii

    • Immunolocalization with anti-MJ0018 antibodies

    • Expression of fluorescently tagged versions (if genetic tools available)

This multi-faceted approach would determine whether MJ0018 is indeed membrane-associated as suggested by its sequence characteristics, and elucidate its specific role in membrane biology .

How can high-throughput screening approaches be adapted to identify potential ligands or substrates for MJ0018?

Adapting high-throughput screening for a protein from a hyperthermophile requires specialized approaches:

  • Thermal shift assays (differential scanning fluorimetry):

    • Screen diverse compound libraries for those that stabilize MJ0018

    • Must be modified for high starting temperatures (potentially 70-80°C)

    • Special instrumentation required for high-temperature fluorescence detection

    • Thermostable fluorescent dyes needed

  • Microarray-based interaction screening:

    • Protein arrays containing purified archaeal proteins to identify partners

    • Small molecule arrays to identify potential ligands

    • Must function at elevated temperatures

  • Metabolite profiling approaches:

    • Incubate MJ0018 with cellular extracts or metabolite pools

    • Use mass spectrometry to identify depleted compounds (potential substrates)

    • Compare results from assays run at different temperatures

  • Functional screening in heterologous systems:

    • Express MJ0018 in mesophilic hosts with reporter systems

    • Screen for phenotypic changes upon exposure to compound libraries

    • May require codon optimization and expression at lower temperatures

  • Computational virtual screening:

    • Use predicted structure of MJ0018 to identify potential binding pockets

    • Dock compound libraries to identify potential ligands

    • Account for structural changes that may occur at elevated temperatures

  • Fragment-based screening approaches:

    • NMR-based fragment screening with 15N-labeled MJ0018

    • Crystallographic fragment screening

    • Thermal stability assays with fragment libraries

The goal of these approaches is to identify molecules that interact with MJ0018, providing clues to its natural substrate or functional partners. All experimental methods must account for the protein's adaptation to high temperatures, which may affect its binding properties and stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.