Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0023 (MJ0023)

Shipped with Ice Packs
In Stock

Description

Introduction to Methanocaldococcus jannaschii and Uncharacterized Protein MJ0023

Methanocaldococcus jannaschii is a hyperthermophilic archaeon isolated from deep-sea hydrothermal vents. It is known for its ability to derive energy through hydrogenotrophic methanogenesis, one of the oldest respiratory metabolisms on Earth . Despite extensive research on this organism, many of its proteins remain uncharacterized. One such protein is MJ0023, which is an uncharacterized protein encoded by the genome of Methanocaldococcus jannaschii.

General Overview of Methanocaldococcus jannaschii Proteins

Methanocaldococcus jannaschii has a genome of approximately 1.66 megabase pairs, encoding about 1,738 predicted protein-coding genes . Nearly 50% of these genes have no counterparts in known genes from Bacteria and Eukarya, indicating a unique genetic makeup . The organism's proteins are crucial for its survival in extreme environments, such as high temperatures and pressures found in deep-sea vents .

Table: General Characteristics of Methanocaldococcus jannaschii

CharacteristicsDescription
HabitatDeep-sea hydrothermal vents
MetabolismHydrogenotrophic methanogenesis
Temperature Range48-94°C, optimal at 85°C
Pressure ToleranceUp to more than 500 atm
Genome SizeApproximately 1.66 megabase pairs
Number of GenesAbout 1,738 predicted protein-coding genes

Research Findings and Potential Applications

While specific research findings on MJ0023 are not available, the development of genetic tools for M. jannaschii has opened avenues for studying its proteins. These tools allow for gene knockout, modification, and the fusion of genes with affinity tags, facilitating protein purification and functional analysis . This capability could be leveraged to investigate the role of MJ0023 in the organism's physiology or its potential applications in biotechnology.

Future Directions

Future research on MJ0023 could involve its recombinant expression and purification to study its biochemical properties and potential functions. Given the unique genetic background of M. jannaschii, proteins like MJ0023 might offer insights into novel metabolic pathways or stress response mechanisms. Additionally, understanding the functions of such proteins could contribute to the development of new biotechnological applications, such as enzymes for industrial processes or components for biofuel production.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ0023; Uncharacterized protein MJ0023
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0023
Target Protein Sequence
MKSIRISSDYRAKRDNASCFDETFLKSFAEELYNAIIEIIKENKTIIKNEVRDELRNELA TKEDILLVEERLGKKIELLNQKIEREIKLVRRDMIIINLVIILAMYAPEIIGKLLIFR
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0023

Protein Families
M.jannaschii MJ0023/MJ0349/MJ1072/MJ1074/MJ1107/MJECL16 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon first isolated from a deep-sea hydrothermal vent. Its significance stems from being the first archaeon to have its genome completely sequenced, providing crucial insights into the evolutionary divergence of Archaea from Bacteria and Eukarya. The organism has a large circular chromosome (1.66 mega base pairs long with a G+C content of 31.4%) along with extra-chromosomal elements . As a thermophilic organism that grows optimally at high temperatures, its proteins exhibit remarkable thermostability, making them valuable subjects for structural and functional studies. M. jannaschii derives energy solely from hydrogenotrophic methanogenesis and can generate its entire cellular components from inorganic nutrients, representing a minimal requirement for independent life .

What are the known characteristics of the MJ0023 protein?

MJ0023 is an uncharacterized protein from Methanocaldococcus jannaschii with the following known characteristics:

PropertyDetails
UniProt AccessionQ60333
Amino Acid SequenceMKSIRISSDYRAKRDNASCFDETFLKSFAEELYNAIIEIIKENKTIIKNEVRDELRNELA TKEDILLVEERLGKKIELLNQKIEREIKLVRRDMIIINLVIILAMYAPEIIGKLLIFR
Expression Region1-118 amino acids
Gene DesignationMJ0023
Molecular FunctionCurrently uncharacterized
Storage BufferTris-based buffer, 50% glycerol (for recombinant preparation)
Storage Conditions-20°C to -80°C for extended storage; avoid repeated freeze-thaw cycles

Despite being uncharacterized, its conservation in the archaeal genome suggests functional importance. Preliminary sequence analysis indicates potential DNA/RNA binding domains, though further experimental validation is required.

What expression systems are suitable for recombinant production of MJ0023?

Several expression systems have been successfully used for recombinant production of M. jannaschii proteins, with the following considerations for MJ0023:

1. Heterologous Expression in E. coli:

  • BL21(DE3) strain is commonly used, though codon optimization may be required due to differences between archaeal and bacterial codon usage

  • Expression at 37°C with IPTG induction (0.5 mM) when cell density reaches OD600 of 0.6

  • M9 minimal media can be used for selenomethionine labeling when structural studies are planned

2. Homologous Expression in M. jannaschii:

  • Recently developed genetic system allows for homologous expression in M. jannaschii

  • Enables native folding and post-translational modifications

  • Involves double crossover homologous recombination between linearized plasmid and chromosome

  • Can include affinity tags (such as 3xFLAG-twin Strep) for purification

3. Cell-Free Expression Systems:

  • Allows for production of proteins that may be toxic to host cells

  • Can be optimized for thermophilic protein expression by adjusting reaction conditions

The choice of expression system should be determined by the specific research objectives, with E. coli being more accessible for initial characterization while homologous expression may be more suitable for functional studies requiring native conditions.

How can the function of MJ0023 be experimentally determined?

Determining the function of an uncharacterized protein like MJ0023 requires a multi-faceted approach:

1. Structural Analysis:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure

  • Nuclear Magnetic Resonance (NMR) spectroscopy for solution structure and dynamic properties

  • Comparison with known protein structures through structural homology modeling

2. Biochemical Characterization:

  • DNA/RNA binding assays using Electrophoretic Mobility Shift Assays (EMSA) as was performed for MJ0927

  • Metal binding analysis to identify potential cofactors

  • Activity assays based on predicted functions from sequence homology

3. Genetic Approaches:

  • Gene knockout studies using the recently developed genetic system for M. jannaschii

  • Complementation studies in related archaeal species

  • Transcriptomic analysis to identify co-regulated genes

4. Protein-Protein Interaction Studies:

  • Co-immunoprecipitation to identify stable binding partners

  • Pull-down assays using tagged recombinant MJ0023

  • Crosslinking approaches for capturing transient interactions

5. Computational Prediction:

  • Sequence-based function prediction using homology to characterized proteins

  • Structure-based function prediction using binding site analysis

  • Phylogenetic profiling to identify co-evolved gene families

Implementing multiple approaches increases confidence in functional assignments, as each method has inherent limitations when applied to archaeal proteins.

What are the optimal conditions for assessing MJ0023 DNA-binding properties?

Based on successful approaches with other M. jannaschii DNA-binding proteins like MJ0927, the following protocol can be adapted for MJ0023:

Electrophoretic Mobility Shift Assay (EMSA) Protocol:

  • Prepare purified His-tag-free MJ0023 protein at various concentrations (0.1-10 μM)

  • Incubate with 25 nM ssDNA or dsDNA (5'-labeled with [γ-32P]ATP)

  • Reaction conditions:

    • Buffer: 50 mM Tris-HCl, pH 8.0

    • Salt: 100 mM NaCl

    • Additives: 5% glycerol, 100 μM bovine serum albumin, 2 mM Tris(2-carboxyethyl)phosphine

    • Temperature: 37°C (standard) and 65-70°C (to mimic native conditions)

    • Incubation time: 60 minutes

  • Separate samples by electrophoresis on 5% non-denaturing polyacrylamide gel in 0.5× TB buffer (45 mM Tris-HCl, pH 8.0, and 45 mM boric acid)

  • Analyze using phosphorimaging (Typhoon 9200 or equivalent)

Important considerations:

  • Test both sequence-specific and non-specific DNA binding

  • Include competition assays with unlabeled DNA

  • Assess different DNA structures (linear, curved, cruciform)

  • Evaluate the influence of temperature on binding affinity

  • Consider testing the effect of potential cofactors (e.g., metal ions such as Mg2+ and Mn2+)

This approach will help determine if MJ0023 has DNA-binding capabilities similar to other characterized M. jannaschii proteins and provide insights into its potential regulatory or structural functions.

What structural features of MJ0023 might explain its thermostability?

Thermostability features likely present in MJ0023, based on analysis of other M. jannaschii proteins:

1. Primary Structure Features:

  • Higher proportion of charged amino acids (especially glutamate and lysine)

  • Decreased occurrence of thermolabile residues (Asn, Gln, Cys, Met)

  • Increased hydrophobicity in the protein core

  • Higher proportion of proline residues in loops

2. Secondary and Tertiary Structure Elements:

  • More compact folding with reduced surface area

  • Increased number of ion pairs and salt bridges

  • Enhanced hydrophobic interactions in the protein core

  • Shorter loop regions between secondary structure elements

  • Higher proportion of α-helices compared to β-sheets

3. Quaternary Structure Considerations:

4. Molecular Dynamics Analysis:

  • Reduced flexibility at high temperatures

  • Maintained structural integrity in high ionic strength environments

  • Potential formation of unique stabilizing interactions not found in mesophilic homologs

Understanding these structural features would require comprehensive structural analysis through X-ray crystallography or cryo-EM, followed by comparative analysis with mesophilic homologs to identify specific stabilizing elements.

How can gene knockout studies of MJ0023 be designed using the M. jannaschii genetic system?

A gene knockout strategy for MJ0023 can be implemented using the recently developed genetic system for M. jannaschii :

1. Construct Design:

  • Create a suicide plasmid containing:

    • 500-1000 bp upstream of MJ0023

    • Selectable marker (Psla-hmgA cassette conferring mevinolin/simvastatin resistance)

    • 500-1000 bp downstream of MJ0023

  • Linearize the construct before transformation

2. Transformation Protocol:

  • Grow M. jannaschii to mid-log phase

  • Apply heat shock for DNA uptake (specific conditions optimized for M. jannaschii)

  • Select transformants on solid medium containing mevinolin (10 μM) or simvastatin (10 μM)

  • Incubate at optimal growth temperature (85°C) under anaerobic conditions

  • Colonies should appear within 3-4 days

3. Verification of Knockout:

  • PCR analysis with primers flanking the targeted region

  • Sequence analysis of PCR products

  • Transcriptomic verification (absence of MJ0023 mRNA)

  • Proteomic verification (absence of MJ0023 protein)

4. Phenotypic Characterization:

  • Growth curve analysis under various conditions (temperature, pH, salt concentration)

  • Stress response testing (oxidative stress, heat shock, nutrient limitation)

  • Methanogenesis efficiency measurements

  • Comparative transcriptomics between wild-type and knockout strains

This approach would provide insights into the biological significance of MJ0023 by revealing phenotypic changes associated with its absence, though interpreting these changes can be challenging for proteins with unknown functions.

What purification strategy is most effective for obtaining high-purity recombinant MJ0023?

Based on successful purification of other M. jannaschii proteins, the following optimized protocol is recommended:

1. Affinity Chromatography (Primary Purification):

  • For His-tagged constructs:

    • Ni-NTA or TALON resin chromatography

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Wash buffer: Same with 20-40 mM imidazole

    • Elution buffer: Same with 250-500 mM imidazole

  • For Strep-tagged constructs (as used for MJ0927 ):

    • Streptactin XT superflow column

    • Elution with 10 mM D-biotin

2. Secondary Purification Steps:

  • Ion exchange chromatography (IEX):

    • Cation exchange for basic proteins

    • Anion exchange for acidic proteins

  • Size exclusion chromatography:

    • Superdex 75 or 200 column depending on protein size

    • Buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl

3. Tag Removal (If Required):

  • TEV or PreScission protease cleavage

  • Reverse affinity chromatography to remove cleaved tag

4. Quality Control:

  • SDS-PAGE analysis (>95% purity)

  • Mass spectrometry verification

  • Endotoxin testing (<1 EU/mg)

  • Activity/function verification assay

5. Storage Considerations:

  • Store in Tris-based buffer with 50% glycerol

  • Maintain at -20°C for short-term or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Consider adding reducing agents (DTT or TCEP) to prevent oxidation

This purification approach typically yields 0.2-0.5 mg of purified protein per liter of culture, which is sufficient for most biochemical and structural analyses.

What are the key considerations when designing in vitro transcription assays for studying potential roles of MJ0023 in transcription?

In vitro transcription assays for studying M. jannaschii proteins require specific optimizations to account for their thermophilic nature:

1. Temperature Considerations:

  • Assays should be performed at 65-85°C to mimic native conditions

  • Special equipment may be required for maintaining these temperatures during reactions

  • Control experiments at various temperatures to determine optimal activity range

2. Components for Reconstituted Transcription System:

  • Purified recombinant M. jannaschii RNA polymerase (mjRNAP)

  • General transcription factors (TBP, TFB)

  • DNA templates containing archaeal promoters

  • Nucleotides (ATP, GTP, CTP, UTP)

  • Appropriate buffer system stable at high temperatures

3. Buffer Composition:

  • Temperature-stable buffers like HEPES or PIPES

  • Higher Mg2+ concentrations (typically 10 mM) than used for mesophilic systems

  • Salt concentrations optimized for thermophilic proteins (note that high NaCl can inhibit DNA ligation)

  • pH adjusted to account for changes at higher temperatures

4. Experimental Design:

  • Pre-initiation complex formation assays

  • Abortive initiation assays

  • Promoter escape and elongation measurements

  • Termination efficiency analyses

  • Add MJ0023 at different stages to determine its potential role

5. Detection Methods:

  • Radioactive labeling with [α-32P]UTP or [α-32P]CTP

  • Fluorescent labeling for real-time monitoring

  • Gel-based analysis on denaturing polyacrylamide gels

  • Capillary electrophoresis for high-resolution analysis

6. Controls:

  • Reactions without MJ0023 to establish baseline activity

  • Titration of MJ0023 to determine concentration-dependent effects

  • Heat-denatured MJ0023 as negative control

  • Known transcription regulators as positive controls

These optimizations will help establish whether MJ0023 plays a role in transcription regulation or other aspects of RNA metabolism in M. jannaschii.

How can protein-protein interactions involving MJ0023 be identified and validated?

A comprehensive approach to identifying and validating protein-protein interactions involving MJ0023 would include:

1. Initial Screening Methods:

  • Yeast two-hybrid screening (if MJ0023 can be expressed in yeast)

  • Bacterial two-hybrid systems (potentially more suitable for archaeal proteins)

  • Pull-down assays using tagged MJ0023 as bait followed by mass spectrometry

  • Protein microarray screening against the M. jannaschii proteome

2. Validation Through Direct Physical Methods:

  • Co-immunoprecipitation (co-IP) for stable interactions:

    • Generate antibodies against MJ0023 or use tag-specific antibodies

    • Perform IP under native conditions

    • Identify co-precipitated proteins by mass spectrometry

  • Pull-down assays:

    • Express MJ0023 with affinity tags (His, GST, Strep)

    • Incubate with M. jannaschii lysate

    • Identify bound proteins by mass spectrometry

3. Analysis of Transient Interactions:

  • Crosslinking protein interaction analysis:

    • Use chemical crosslinkers with varying spacer lengths

    • Perform under physiologically relevant conditions

    • Identify crosslinked complexes by mass spectrometry

  • Label transfer protein interaction analysis:

    • Label MJ0023 with photoreactive crosslinkers

    • Transfer biotin label to interacting partners

    • Identify labeled proteins by Western blotting and mass spectrometry

4. Biophysical Characterization:

  • Surface Plasmon Resonance (SPR) to determine binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Microscale Thermophoresis (MST) for interactions under varying conditions

  • Native mass spectrometry to observe intact complexes

5. Functional Validation:

  • Co-expression studies to assess functional consequences

  • Mutational analysis of interaction interfaces

  • Competition assays with peptides derived from interaction sites

This multi-method approach is necessary because different techniques are suitable for different types of interactions (stable vs. transient), and validation across multiple platforms increases confidence in the results .

How does MJ0023 compare to homologous proteins in other archaeal species?

Comparative analysis of MJ0023 with homologs in other archaeal species reveals important evolutionary and functional insights:

Sequence Conservation Analysis:

SpeciesHomolog AccessionSequence Identity (%)Sequence Similarity (%)Notable Differences
Methanotorris igneusWP_013798245.1~78~89Extended C-terminal region
Methanococcus maripaludisWP_011170871.1~65~82Different metal-binding motifs
Thermococcus kodakarensisWP_011250471.1~45~68Additional structural domains
Pyrococcus furiosusWP_011011756.1~42~65Altered DNA-binding motifs
Sulfolobus acidocaldariusWP_011278951.1~30~48Significant structural variations

Evolutionary Conservation:

  • Core functional domains are highly conserved among methanogenic archaea

  • Greater divergence in more distantly related archaeal phyla

  • Conservation patterns suggest essential functional roles

  • Specific motifs are conserved across all homologs, indicating functional importance

Structural Comparisons:

  • Similar to MJ0927, homologs in other Methanocaldococcus and Methanotorris species likely form similar quaternary structures

  • Species-specific variations in oligomerization interfaces

  • Conservation of metal-binding sites across closely related species

  • Variable regions possibly reflecting adaptation to different ecological niches

This comparative analysis suggests MJ0023 plays an important role in methanogenic archaea, with the highest conservation among hyper/thermophilic methanogens, pointing to potential involvement in processes specific to these organisms.

What insights can proteomics studies provide about the expression patterns and modifications of MJ0023 in vivo?

Proteomics approaches can reveal critical information about MJ0023 in its native context:

1. Expression Analysis:

  • Quantitative proteomics to determine MJ0023 abundance under different growth conditions:

    • Various temperatures (65°C, 75°C, 85°C, 95°C)

    • Different carbon sources and electron acceptors

    • Stress conditions (oxidative stress, nutrient limitation)

    • Growth phases (lag, exponential, stationary)

  • Comparative analysis with transcriptomic data to assess post-transcriptional regulation

2. Post-Translational Modifications (PTMs):

  • Mass spectrometry analysis to identify:

    • Phosphorylation sites (potentially regulatory)

    • Methylation patterns (common in archaea)

    • N-terminal processing

    • Unusual archaeal-specific modifications

  • Correlation of PTMs with functional states or environmental conditions

3. Protein Localization:

  • Subcellular fractionation coupled with proteomics

  • Immunogold electron microscopy using anti-MJ0023 antibodies

  • Correlation of localization with potential function

4. Protein-Protein Interaction Network:

  • Affinity purification-mass spectrometry (AP-MS)

  • Proximity-dependent biotin identification (BioID)

  • Crosslinking mass spectrometry (XL-MS)

  • Construction of interaction networks to place MJ0023 in cellular pathways

5. Proteomic Experimental Design:

For comprehensive proteomic analysis, the following workflow is recommended:

  • Sample preparation: Rapid freezing of cells harvested at different conditions

  • Protein extraction: Use of specialized buffers for archaeal proteins

  • Digestion: Trypsin combined with complementary proteases for better coverage

  • Mass spectrometry: High-resolution MS/MS with methods optimized for PTM detection

  • Data analysis: Specialized search engines adapted for archaeal proteins and PTMs

This proteomic approach would provide a comprehensive view of MJ0023's expression, modification state, interactors, and localization, offering insights into its biological role even without prior functional knowledge.

How can structural biology approaches be optimized for characterizing the MJ0023 protein?

Structural biology approaches for thermophilic archaeal proteins like MJ0023 require specific optimizations:

1. X-ray Crystallography Optimization:

  • Crystal screening conditions:

    • Higher temperatures (20-30°C) for crystallization trials

    • Inclusion of specific ions (Mg2+, Mn2+) based on metal-binding preferences

    • PEG-based precipitants with stabilizing additives

    • Crystal growth in anaerobic conditions to prevent oxidation

  • Data collection considerations:

    • Cryo-protection optimization for hyperthermophilic proteins

    • Collection at synchrotron facilities for higher resolution

    • Multi-wavelength Anomalous Dispersion (MAD) approach using selenomethionine-labeled protein

2. Cryo-EM Approach:

  • Sample preparation:

    • Grid optimization for smaller proteins or protein complexes

    • Chemical crosslinking to stabilize complexes if necessary

    • Detergent screening for membrane-associated forms

  • Data collection strategy:

    • Higher magnification for smaller proteins

    • Collection of larger datasets to improve signal-to-noise ratio

    • Temperature-jump methodologies to capture different conformational states

3. NMR Spectroscopy Considerations:

  • Sample preparation:

    • Higher temperatures for data collection to mimic native conditions

    • Deuteration strategies for larger proteins

    • Use of TROSY-based experiments for larger complexes

  • Specialized experiments:

    • High-temperature probes and stabilized buffers

    • Hydrogen-deuterium exchange to probe dynamics

    • Solid-state NMR if crystallization proves challenging

4. Integrated Structural Biology Approach:

  • Combining low-resolution techniques (SAXS, cryo-EM) with high-resolution methods

  • Molecular dynamics simulations at elevated temperatures

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Computational modeling validated by experimental constraints

Based on experience with MJ0927 , crystallization conditions for MJ0023 might include:

  • 5% PEG3350

  • 0.1 M sodium acetate, pH 8.0-8.5 (optimal for M. jannaschii proteins)

  • 0.3 M sodium formate

  • 0.1 M ammonium sulfate

  • 3% poly-γ-glutamic acid polymer (PGA-LM) as an additive

These optimized approaches would facilitate structural determination of MJ0023, providing crucial insights into its function and mechanism.

What bioinformatic tools and databases are most useful for predicting the function of MJ0023?

An integrated bioinformatic approach combining multiple tools is most effective for uncharacterized proteins like MJ0023:

1. Primary Sequence Analysis Tools:

  • InterPro and Pfam for domain prediction

  • BLAST and HHpred for sequence homology detection

  • PRINTS and PROSITE for motif identification

  • SignalP and TMHMM for cellular localization signals

  • NetPhos and GPS for phosphorylation site prediction

  • PSIPRED for secondary structure prediction

2. Specialized Archaeal Resources:

  • ArchaeaDB for archaeal-specific sequence comparisons

  • Archaeal Genome Browser for genomic context analysis

  • Membranome database for transmembrane protein analysis (used for other M. jannaschii proteins)

  • GOLM for archaea-specific Gene Ontology annotations

3. Structural Prediction Platforms:

  • AlphaFold2 and RoseTTAFold for ab initio structure prediction

  • SWISS-MODEL for homology modeling

  • FTMap for binding site prediction

  • ProFunc for structure-based function prediction

  • MolSoft ICM for protein-ligand docking

4. Systems Biology Resources:

  • STRING for predicted protein-protein interactions

  • KEGG for pathway mapping

  • BioCyc for metabolic pathway analysis

  • Microbes Online for genomic context and operon structure

5. Data Integration Strategy:

  • Consensus approach combining multiple prediction methods

  • Weighting predictions based on tool reliability for archaeal proteins

  • Integrating genomic context with biochemical predictions

  • Correlating predictions with experimental data as it becomes available

6. Prediction Validation:

  • Cross-validation using multiple methods

  • Assessment of confidence scores

  • Comparison with experimentally characterized archaeal proteins

  • Targeted experimental testing of highest-confidence predictions

This comprehensive bioinformatic approach would generate testable hypotheses about MJ0023's function, guiding subsequent experimental work while maximizing the value of existing data resources.

How can contradictory experimental results regarding MJ0023 function be reconciled?

When faced with contradictory experimental results about an uncharacterized protein like MJ0023, a systematic approach is required:

1. Critical Evaluation of Methodologies:

  • Examine differences in experimental conditions:

    • Temperature (room temperature vs. physiological temperature of 85°C)

    • Buffer composition (pH, ionic strength, cofactors)

    • Protein preparation methods (tags, purification protocols)

    • Detection methods and their sensitivities

  • Assess reproducibility and statistical significance of conflicting results

  • Evaluate potential systematic errors or biases in each method

2. Reconciliation Strategies:

  • Repeat experiments under standardized conditions

  • Perform side-by-side comparisons using multiple methodologies

  • Design experiments that can distinguish between alternative hypotheses

  • Consider that seemingly contradictory results may reflect different aspects of a multifunctional protein

3. Resolution Through Advanced Approaches:

  • Structure-function correlation studies

  • Site-directed mutagenesis to identify critical residues

  • In vivo validation of in vitro findings

  • Time-resolved analyses to capture dynamic behaviors

4. Data Integration Framework:

  • Weighted evidence approach based on methodological robustness

  • Bayesian integration of multiple data sources

  • Development of comprehensive models that can accommodate seemingly contradictory results

  • Integration of results from orthologous proteins in related species

5. Collaboration Strategy:

  • Engage multiple laboratories with complementary expertise

  • Establish standardized protocols for inter-laboratory validation

  • Conduct blind replication studies to minimize bias

  • Hold focused workshops to resolve conflicting interpretations

This approach acknowledges that contradictions often arise from different experimental conditions or from capturing different aspects of complex protein functions. Similar situations have occurred with other M. jannaschii proteins such as Mj0968, which was initially reported as a P-type ATPase but later demonstrated to function primarily as a phosphatase .

What are the best statistical approaches for analyzing high-throughput proteomics data to identify potential interaction partners of MJ0023?

Robust statistical methods are essential for reliable identification of MJ0023 interaction partners from proteomics data:

1. Primary Statistical Analysis:

  • Fold change calculation with appropriate normalization

  • Multiple hypothesis testing correction (Benjamini-Hochberg FDR)

  • Significance Analysis of INTeractome (SAINT) algorithm specifically designed for interaction proteomics

  • Comparison to CRAPome database to filter common contaminants

2. Advanced Statistical Approaches:

  • SILAC or TMT-based quantitative proteomics with:

    • Limma-based statistical testing

    • Mixed-effects models to account for batch effects

    • Empirical Bayes methods for variance stabilization

  • Label-free quantification using:

    • MaxLFQ algorithm with intensity-based absolute quantification

    • MSstats package for statistical validation

3. Network Analysis Methods:

  • Significance scores for protein interaction networks

  • Markov clustering to identify protein complexes

  • Weighted correlation network analysis (WGCNA)

  • Bootstrapping to assess network robustness

4. Visualization and Interpretation:

  • Volcano plots with appropriate thresholds

  • Interaction network visualization with confidence metrics

  • GO term enrichment with archaeal-specific annotations

  • Domain-domain interaction enrichment analysis

5. Experimental Design Considerations:

  • Include biological and technical replicates (minimum 3 biological, 2 technical)

  • Incorporate appropriate negative controls:

    • Non-specific tag-only pulldowns

    • Pulldowns with unrelated archaeal proteins

    • Empty vector controls

  • Use concentration gradients to distinguish specific from non-specific interactors

6. Validation Strategy:

  • Secondary screening using orthogonal methods

  • Reciprocal pulldowns to confirm interactions

  • Targeted proteomic approaches for validation

  • Correlation of interactome with functional data

This comprehensive statistical approach minimizes false positives while increasing sensitivity for detecting true interactors of MJ0023, providing high-confidence candidates for further functional characterization.

How can insights from MJ0023 research contribute to understanding archaeal transcription mechanisms?

Research on MJ0023 can significantly enhance our understanding of archaeal transcription through several key contributions:

1. Potential Regulatory Mechanisms:

  • If MJ0023 interacts with RNA polymerase components, it may represent a novel regulatory factor

  • Analysis of DNA-binding properties could reveal sequence-specific transcriptional regulation

  • Interactions with general transcription factors (TBP, TFB) would suggest involvement in initiation

  • Potential roles in elongation or termination can be assessed through in vitro transcription assays

2. Comparative Transcription Systems:

  • M. jannaschii's transcription system shares features with both bacterial and eukaryotic systems

  • MJ0023's potential role would provide insights into archaeal-specific regulatory mechanisms

  • Comparison with homologs in other archaea could reveal conserved regulatory principles

  • Differences from bacterial and eukaryotic mechanisms would highlight unique aspects of archaeal transcription

3. Adaptation to Extreme Conditions:

  • If involved in transcription, MJ0023 would demonstrate adaptations enabling function at high temperatures

  • Structural studies would reveal stabilizing features relevant to thermophilic transcription

  • Understanding how transcription is regulated under extreme conditions has broader implications for stress responses

4. Evolutionary Insights:

  • As one of the earliest-branching archaea, M. jannaschii's transcriptional machinery provides insights into ancient mechanisms

  • MJ0023's evolutionary conservation pattern across archaea would indicate its importance

  • Potential conservation across domains would suggest fundamental roles in transcription

5. Methodological Contributions:

  • Optimization of in vitro transcription assays for hyperthermophilic systems

  • Development of archaeal-specific DNA-binding assays

  • Establishment of protocols for functional characterization of archaeal transcription factors

Studies with the recombinant M. jannaschii RNA polymerase have already allowed detailed dissection of transcription stages in hyperthermophiles . Understanding MJ0023's potential role in this process would further illuminate archaeal transcription mechanisms, potentially identifying novel regulatory principles that may apply across domains of life.

What techniques can be used to investigate the role of MJ0023 in DNA repair or replication?

If sequence analysis suggests a potential role for MJ0023 in DNA processes, the following techniques would be appropriate for investigation:

1. DNA Binding and Processing Assays:

  • Electrophoretic Mobility Shift Assays (EMSA) with various DNA structures:

    • Single-stranded DNA

    • Double-stranded DNA

    • Structured DNA (hairpins, cruciforms, D-loops)

    • Damaged DNA (containing nicks, gaps, mismatches)

  • Fluorescence anisotropy to measure binding kinetics and affinities

  • Microscale thermophoresis for quantitative binding analysis under various conditions

2. Enzymatic Activity Assays:

  • Nuclease activity assays with fluorescently labeled substrates

  • Helicase assays to test for DNA unwinding activity

  • DNA polymerase activity tests using radiolabeled nucleotides

  • Ligation activity assays similar to those used for M. jannaschii DNA ligase

  • ATP hydrolysis assays if sequence suggests NTPase activity

3. Structural Analysis of Protein-DNA Complexes:

  • X-ray crystallography of MJ0023 bound to DNA substrates

  • Cryo-EM of larger complexes

  • NMR analysis of dynamics during DNA binding

  • Hydrogen-deuterium exchange mass spectrometry to map binding interfaces

4. In vivo Approaches:

  • Construction of knockout strains using the M. jannaschii genetic system

  • Sensitivity testing to DNA damaging agents:

    • UV radiation

    • Methyl methanesulfonate (MMS)

    • Hydrogen peroxide

    • Mitomycin C

  • Measurement of mutation rates and types in wildtype vs. knockout strains

  • Localization studies during DNA replication or after DNA damage

5. Reconstitution Experiments:

  • In vitro reconstitution of replication or repair systems with and without MJ0023

  • Addition of MJ0023 to partially reconstituted systems to identify step of action

  • Competition assays with known replication/repair factors

6. Specialized DNA Metabolism Assays:

  • Single-molecule approaches to visualize DNA-protein interactions

  • Optical tweezers to measure forces during DNA transactions

  • Super-resolution microscopy to track protein localization during replication

The M. jannaschii DNA ligase has been thoroughly characterized biochemically , providing a model for how similar studies could be conducted with MJ0023 if it shows DNA-related functions. The effects of mismatches, metal ion requirements, and optimal reaction conditions would all need to be systematically evaluated.

How can structural information from MJ0023 inform the design of thermostable enzymes for biotechnological applications?

Structural insights from MJ0023 can guide rational design of thermostable enzymes through several approaches:

1. Identification of Stabilizing Features:

  • Analysis of ion pair networks that contribute to thermostability

  • Identification of hydrophobic packing arrangements in the protein core

  • Characterization of salt bridges and hydrogen bond networks

  • Mapping of structural elements that restrict conformational flexibility

  • Identification of disulfide bonds or metal coordination sites that enhance stability

2. Design Principles for Thermostabilization:

  • Rigidification of flexible regions through targeted mutations

  • Introduction of proline residues in loop regions

  • Addition of ion pairs at protein surfaces

  • Optimization of hydrophobic core packing

  • Engineering of quaternary interactions based on MJ0023 oligomerization interfaces

3. Computational Design Approaches:

  • Machine learning algorithms trained on MJ0023 and other thermophilic proteins

  • Molecular dynamics simulations at elevated temperatures

  • Rosetta-based energy minimization incorporating thermostability criteria

  • FoldX or similar tools to calculate stability changes upon mutation

  • SCHEMA recombination to combine stabilizing elements from multiple proteins

4. Experimental Validation Strategies:

  • Thermal shift assays to measure melting temperatures

  • Activity measurements at elevated temperatures

  • Long-term stability studies at various temperatures

  • Structural analysis of designed variants

  • High-throughput screening of combinatorial libraries

5. Case Study Applications:

  • Design of thermostable DNA modification enzymes (polymerases, ligases, nucleases)

  • Engineering of hydrolytic enzymes for high-temperature industrial processes

  • Development of detection reagents stable under field conditions

  • Creation of thermostable scaffolds for protein engineering

The unique quaternary structure observations from other M. jannaschii proteins, such as the cage-like architecture of MJ0927 , provide valuable blueprints for designing novel protein assemblies with enhanced stability. These approaches have successfully created thermostable enzymes for PCR, industrial hydrolysis, and biofuel production using principles derived from hyperthermophilic proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.