Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0067 (MJ0067)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0067 (MJ0067)

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0067 (MJ0067) is a bioengineered variant of a hypothetical protein encoded by the MJ0067 gene in the thermophilic archaeon Methanocaldococcus jannaschii. This protein remains functionally uncharacterized, though its recombinant production enables structural and biochemical studies . M. jannaschii, isolated from deep-sea hydrothermal vents, is a model organism for studying extremophiles due to its survival in high-temperature environments (48–94°C) .

Production and Purification Methodology

MJ0067 is expressed in E. coli and purified via affinity chromatography due to its His-tag. Post-purification steps include:

  • Reconstitution: Dissolved in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stabilization .

  • Storage: Long-term storage at -20°C/-80°C, with working aliquots maintained at 4°C for ≤1 week .

Key Considerations:

  • Avoid repeated freeze-thaw cycles to preserve activity.

  • SDS-PAGE confirms monodispersity and absence of degradation .

Research Applications and Biochemical Insights

While MJ0067’s biological role remains undefined, its recombinant form supports:

  • ELISA Development: Kits for detecting MJ0067-specific antibodies (e.g., CSB-CF730617MRU) .

  • Pathway Analysis: Potential involvement in archaeal-specific metabolic or cofactor synthesis pathways, though experimental validation is lacking .

Structural Hypotheses:
The presence of hydrophobic residues (e.g., Val, Ile, Leu) suggests possible membrane association, but no transmembrane domains are annotated in public databases .

Stability and Handling Recommendations

MJ0067’s stability is influenced by:

ParameterRecommendation
Storage-20°C/-80°C in lyophilized form; avoid moisture exposure
ReconstitutionUse sterile water; add glycerol (50% v/v) for long-term stability
ThawingBrief centrifugation before opening to collect contents

Comparative Analysis of Recombinant Proteins

MJ0067 differs from other M. jannaschii proteins (e.g., MJ0356) in host expression systems and functional annotations:

ProteinExpression HostPurityTagLength
MJ0067E. coli>90%HisFull-length (1–103)
MJ0356Mammalian cells>85%UndeterminedFull-length (1–97)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order remarks section, and we will prepare accordingly.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
MJ0067; Uncharacterized protein MJ0067
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0067
Target Protein Sequence
MIILDFSQFLPDIGSGFIIGFVIGWAAKKAIKVVAFLIGIYILSLLYLAKIGVISINKEA FSALLGNLENSLLVFGDKIIGLIHSFSFGTSFLIGFGLGFKKG
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0067

STRING: 243232.MJ_0067

Protein Families
FUN14 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is MJ0067 significant for study?

Methanocaldococcus jannaschii is a deeply rooted, hyperthermophilic methanogen that lives in deep-sea hydrothermal vents where conditions mimic those of early Earth . This organism produces methane exclusively from H₂ and CO₂ via a process believed to represent an ancient form of respiration . The study of uncharacterized proteins like MJ0067 from this organism provides unique opportunities to understand archaeal biology, extremophile adaptation mechanisms, and potentially ancient protein functions.

The significance of studying MJ0067 lies in several factors. First, as an uncharacterized protein, it represents a knowledge gap in our understanding of archaeal biology. Second, proteins from M. jannaschii often possess unique structural features that enable function under extreme conditions. Third, comparative analysis with homologs in other species may reveal evolutionarily conserved functions important for understanding early life.

To begin characterization of MJ0067, researchers typically start with sequence analysis to identify conserved domains, followed by recombinant expression and purification for functional and structural studies.

What expression systems are most suitable for producing recombinant MJ0067?

The expression of archaeal proteins, particularly from hyperthermophiles like M. jannaschii, presents unique challenges due to differences in codon usage, post-translational modifications, and protein folding requirements. For MJ0067, several expression systems can be considered:

  • E. coli expression systems: The most commonly used approach involves codon-optimized constructs in E. coli strains like BL21(DE3) or Rosetta(DE3) . These systems offer high protein yields but may require optimization of induction conditions (temperature, IPTG concentration) and solubility enhancers (fusion tags, chaperones).

  • Yeast expression systems: For proteins that require eukaryotic-like post-translational modifications, Pichia pastoris or Saccharomyces cerevisiae can be viable alternatives.

  • Cell-free expression systems: These can be particularly useful for archaeal proteins that may be toxic to host cells or require special folding conditions.

For optimal expression of MJ0067, researchers should consider a design cycle approach where different expression constructs and conditions are systematically tested . Initial screening might include multiple fusion tags (His, GST, MBP, SUMO) and expression temperatures (16-37°C). For hyperthermophilic proteins, lower expression temperatures (16-25°C) often improve solubility despite being counterintuitive.

How can researchers assess the thermal stability of recombinant MJ0067?

As a protein from a hyperthermophilic organism, MJ0067 is expected to exhibit significant thermal stability. Several methodological approaches can be employed to characterize this property:

  • Differential Scanning Calorimetry (DSC): This technique directly measures the heat capacity of a protein solution as a function of temperature, providing the melting temperature (Tm) and thermodynamic parameters of unfolding.

  • Circular Dichroism (CD) Spectroscopy: Temperature-dependent CD measurements at specific wavelengths (typically 222 nm for α-helical structures) allow monitoring of secondary structure changes during thermal denaturation.

  • Thermal Shift Assays (TSA): Also known as Differential Scanning Fluorimetry, this method uses environment-sensitive fluorescent dyes to monitor protein unfolding with increasing temperature.

  • Activity Assays at Different Temperatures: For proteins with known activities, measuring function retention after exposure to increasing temperatures provides practical stability information.

The recommended approach is to combine multiple methods, starting with TSA for initial screening due to its low protein requirement, followed by CD and DSC for more detailed characterization. When analyzing MJ0067 thermal stability data, researchers should compare results with known M. jannaschii proteins as reference points, since typical stability thresholds for mesophilic proteins may not apply .

What bioinformatic approaches can predict potential functions of MJ0067?

For uncharacterized proteins like MJ0067, bioinformatic analysis is a crucial first step toward functional characterization. A systematic approach should include:

  • Sequence-Based Predictions:

    • PSI-BLAST and HHpred searches against protein databases

    • Motif/domain identification using InterPro, PFAM, and CDD

    • Transmembrane region prediction (TMHMM, Phobius)

    • Signal peptide prediction (SignalP)

  • Structural Predictions:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Identification of structural homologs using DALI or TM-align

    • Binding site prediction using CASTp or FTSite

  • Genomic Context Analysis:

    • Examination of neighboring genes in the genome

    • Co-occurrence patterns across species

    • Gene fusion events

  • Expression Pattern Analysis:

    • Mining public transcriptomics/proteomics data

    • Identification of co-expressed genes

When analyzing MJ0067, particular attention should be paid to archaeal-specific features and potential associations with known methanogens pathways. The identification of potential redox-active sites would be particularly interesting given the importance of redox regulation in methanogens .

How can crosslinking mass spectrometry be optimized to identify MJ0067 interaction partners?

Crosslinking mass spectrometry (XL-MS) is a powerful approach for mapping protein interactions directly in cellular contexts. For identifying MJ0067 interaction partners in M. jannaschii, the following optimized protocol can be implemented:

  • Crosslinker Selection: For thermophilic organisms, use crosslinkers with thermal stability. The membrane-permeable crosslinker DSSO is effective for whole-cell approaches .

  • Crosslinking Conditions: Since M. jannaschii is an anaerobe, perform all steps in an anaerobic chamber. Optimize crosslinking time (typically 5-30 min) and temperature (consider performing at higher temperatures relevant to M. jannaschii's optimal growth).

  • Sample Processing:

    • Cell lysis under anaerobic conditions

    • Protein fractionation to reduce complexity

    • Trypsin digestion of proteins

    • Enrichment of crosslinked peptides

  • MS Analysis and Data Processing:

    • Use MS-cleavable crosslinkers for improved identification

    • Apply stringent filtering criteria to control false discovery rates

    • Use specialized software (e.g., XlinkX, pLink) for crosslink identification

  • Validation Strategies:

    • Co-fractionation MS to confirm stable interactions

    • Generation of tagged constructs for pull-down validation

    • Structural modeling of predicted interactions

Based on studies with other uncharacterized proteins, crosslinking stabilizes many interactions that would otherwise be lost during cell lysis and fractionation . For MJ0067, this approach could reveal functional associations that would be difficult to predict through sequence analysis alone.

Table 1: Comparison of Crosslinking Reagents for Thermophilic Protein Interaction Studies

CrosslinkerSpacer Arm LengthMembrane PermeabilityMS-CleavableThermal StabilityRecommended Concentration
DSSO10.3 ÅYesYesModerate0.5-2 mM
DSS11.4 ÅYesNoModerate0.5-2 mM
BS311.4 ÅNoNoModerate1-3 mM
DTSSP12.0 ÅNoYesGood1-5 mM
Formaldehyde2.3-2.7 ÅYesNoExcellent0.5-3%

What structural approaches are most effective for determining the three-dimensional structure of MJ0067?

Determining the structure of uncharacterized proteins like MJ0067 requires a multi-faceted approach. The following strategies, presented in order of increasing resolution and complexity, are recommended:

A rational design approach involves iterative cycles of prediction, experimental validation, and refinement . For MJ0067, initial computational models should guide construct design for expression and crystallization trials. Given the hyperthermophilic nature of M. jannaschii, protein stability at elevated temperatures may actually facilitate crystallization by reducing conformational heterogeneity.

The most efficient strategy often combines AlphaFold2 prediction with experimental validation via CD and SAXS, followed by crystallization trials of engineered constructs with optimized surface properties.

How can researchers determine if MJ0067 plays a role in the oxidative stress response of M. jannaschii?

Given that redox regulation is crucial in methanogens like M. jannaschii, investigating whether MJ0067 plays a role in oxidative stress response requires systematic approaches:

  • Sequence and Structure Analysis:

    • Examine for redox-active motifs (e.g., CXXC as in thioredoxins)

    • Look for structural similarity to known oxidative stress proteins

    • Analyze cysteine conservation patterns across homologs

  • Biochemical Characterization:

    • Thiol reactivity assays to detect redox-active cysteines

    • Insulin reduction assay (if thioredoxin-like activity is suspected)

    • DTT-dependent activity assays

    • Peroxidase activity assays if peroxiredoxin-like features are present

  • Interaction Studies:

    • Pull-down assays with known redox proteins from M. jannaschii

    • Crosslinking MS to identify interaction partners

    • Yeast two-hybrid screening against M. jannaschii protein library

  • Functional Studies:

    • Expression level changes under oxidative stress conditions

    • Complementation studies in model organisms lacking oxidative stress proteins

    • Site-directed mutagenesis of potential redox-active residues

Comparative analysis with known redox-active proteins in M. jannaschii, such as Trx1 (Mj_0307) and Trx2 (Mj_0581), could provide valuable insights . If MJ0067 contains cysteine residues, examining their arrangement in the predicted structure would be particularly informative, as the spatial orientation of cysteines is critical for redox function.

What methodologies can identify post-translational modifications in recombinant MJ0067?

Post-translational modifications (PTMs) can significantly impact protein function. For recombinant MJ0067, a comprehensive PTM analysis should include:

  • Mass Spectrometry-Based Approaches:

    • Bottom-up proteomics: Tryptic digestion followed by LC-MS/MS

    • Top-down proteomics: Analysis of intact protein

    • Targeted analysis for specific modifications using neutral loss scans or multiple reaction monitoring

    • Enrichment strategies for specific PTMs (e.g., TiO₂ for phosphopeptides)

  • Specific PTM Detection Methods:

    • ProQ Diamond/Emerald staining for phosphorylation and glycosylation

    • Western blotting with PTM-specific antibodies

    • Chemical labeling approaches (e.g., biotin-switch technique for S-nitrosylation)

  • Comparative Analysis:

    • Native vs. recombinant protein comparison

    • Effect of expression system on PTM patterns

    • Comparison of PTMs under different growth conditions

For archaeal proteins like MJ0067, particular attention should be paid to unique archaeal modifications such as N-linked glycosylation on asparagine residues within N-X-S/T motifs, methylation, and unusual phosphorylation patterns. The comparison of PTMs between native and recombinant proteins is especially important as heterologous expression systems may not reproduce the natural PTM profile.

Table 2: Common Post-Translational Modifications and Detection Methods for Archaeal Proteins

ModificationDetection MethodSample PreparationResolution LimitSpecial Considerations for Archaeal Proteins
PhosphorylationLC-MS/MS with TiO₂ enrichmentTryptic digestionSite-specificMay occur on unusual residues in archaea
GlycosylationGlycosidase treatment + MSIntact or digested proteinSite-specificN-linked glycans in archaea have unique structures
MethylationMS with neutral loss scanningTryptic digestionSite-specificCommon in hyperthermophiles
AcetylationAntibody-based enrichment + MSTryptic digestionSite-specificMay stabilize proteins at high temperatures
Disulfide bondsNon-reducing vs. reducing gelsIntact proteinPresence/absenceCritical for thermostability in many cases

How can researchers design a knockout or knockdown system to study MJ0067 function in vivo?

Genetic manipulation of archaea, particularly hyperthermophiles like M. jannaschii, presents significant challenges. The following approaches can be considered for studying MJ0067 function through gene deletion or expression modulation:

  • CRISPR-Cas9 System Adaptation:

    • Design archaeal codon-optimized Cas9

    • Use thermostable Cas9 variants for hyperthermophiles

    • Design guide RNAs targeting MJ0067

    • Include homology-directed repair template for marker insertion

  • Traditional Homologous Recombination:

    • Design constructs with selectable markers flanked by MJ0067 homology regions

    • Use pyrE/pyrF-based counterselection systems

    • Optimize transformation protocols for high-temperature organisms

  • Conditional Expression Systems:

    • Develop tightly regulated promoter systems functional in M. jannaschii

    • Consider tetracycline-responsive elements or similar inducible systems

    • Design antisense RNA approaches if direct knockout is challenging

  • Heterologous Complementation:

    • Express MJ0067 in model organisms with deletions of putative functional homologs

    • Test for phenotype rescue as an indicator of functional conservation

    • Use temperature-sensitive mutants of model organisms for complementation at elevated temperatures

  • Model Organism Alternatives:

    • Consider using more genetically tractable methanogens or archaea as models

    • Methanococcus maripaludis or Thermococcus kodakarensis may serve as alternative systems

Given the experimental challenges, combining computational predictions, in vitro characterization, and targeted genetic approaches in more tractable related organisms may provide the most comprehensive understanding of MJ0067 function.

How can researchers integrate multi-omics data to understand MJ0067 function in cellular context?

Multi-omics integration provides a powerful approach to contextualizing uncharacterized proteins like MJ0067 within cellular networks. A comprehensive integration strategy includes:

  • Data Collection and Preprocessing:

    • Genomics: Analyze genomic context and conservation

    • Transcriptomics: Examine expression patterns under different conditions

    • Proteomics: Identify protein abundance, modifications, and interactions

    • Metabolomics: Detect metabolic changes in response to protein perturbation

  • Network Analysis Approaches:

    • Co-expression networks to identify functionally related genes

    • Protein-protein interaction networks from crosslinking MS and co-fractionation data

    • Metabolic networks to place the protein in biochemical pathways

    • Integrated multi-layer networks combining different data types

  • Machine Learning Integration:

    • Supervised learning for function prediction using multiple data types

    • Unsupervised clustering to identify functional modules

    • Deep learning approaches for complex pattern recognition

  • Visualization and Interpretation Tools:

    • Cytoscape for network visualization

    • R/Python packages for statistical analysis and plotting

    • Specialized archaeal databases like ArchaeaDB

For MJ0067, particular attention should be paid to co-expression with genes involved in methanogenesis and stress response pathways, as these represent core functionalities in M. jannaschii . Crosslinking MS data is especially valuable for uncharacterized proteins, as it can reveal direct physical interactions that suggest functional roles .

What structural comparison approaches can provide insights into potential MJ0067 function?

Structural comparison can provide critical functional insights even when sequence similarity is low. For MJ0067, the following approaches are recommended:

The structural comparisons should focus not only on proteins from other archaea but also on functionally characterized proteins from bacteria and eukaryotes with similar structural features. Special attention should be given to proteins involved in metabolic processes relevant to methanogens, particularly those related to carbon fixation, energy conversion, and redox homeostasis .

Table 3: Structural Analysis Tools for Uncharacterized Protein Function Prediction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.