Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0107 (MJ0107)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0107; Uncharacterized protein MJ0107
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0107
Target Protein Sequence
MREIMKILIITGKLAERKVKDAVKKYDFIDVHVANISVAAFLTPNLIIKEIKKLENKLGK KLKDIYDFVLVTGLIRHDLKNVEEETGIKCFKSTREASDIPILIENLDKIKLSTKEYADL QLLEIIRKKCEEEIKKAEEQELGEGDIKIGKLKVGDKFPMRVLGEIVHAPWLKEKELEEK IIYYLESGADMIDLGMVSNENNADKIKDMLKIARDLTDNPISVDTLNTKELIEAINLGAD MILSVDAGNLDELIPYLKDSETAVVVLPTNYKTNYVPETIEGKIKSLEENIKKLIDAGIE KIVADPILEPINNAGCSFIESVIACREFKKRNKLPLFFGVGNVTELFDADSNGVNALLAA IGAEIGANILFTPEASAKCKFSIKELKIASKMMFLAKKRNSLPKDIGYNLINYKDKRFEE EITFNSYNIPIIKAEEDERQILDEGSFKIEIDRKNKEIVAIYFNKRREPVLIIRGKKPKE IYETAIRLNLIKKLDHASYFGRELAKAEIALRIGKKYNQDFDLFL
Uniprot No.

Target Background

Function
Function unknown. Lacks dihydropteroate synthase (DHPS) activity; it does not catalyze the condensation of 6-hydroxymethyl-7,8-dihydropterin pyrophosphate (DHPP) and 4-aminobenzoate to form 7,8-dihydropteroate.
Database Links

KEGG: mja:MJ_0107

STRING: 243232.MJ_0107

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for protein research?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon first isolated from a deep-sea hydrothermal vent at 2600m depth on the East Pacific Rise. This organism grows at temperatures between 48-94°C (optimum ~85°C) and pressures up to 500 atmospheres . Its significance stems from being the first archaeon to have its whole genome sequenced in 1996 . As a phylogenetically deeply rooted organism that derives energy solely from hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O), it represents an excellent model for studying early Earth metabolism .

M. jannaschii can generate its entire cell from inorganic nutrients, representing a minimal requirement for life independent of other living systems . Notably, approximately 60% of its genes had no assigned functions when first sequenced, including MJ0107, making it a rich source of novel proteins for biochemical investigation .

How is recombinant MJ0107 expressed and purified?

The expression and purification of recombinant MJ0107 typically follows a protocol similar to other M. jannaschii proteins, with modifications to account for its transmembrane nature:

  • Cloning: The MJ0107 gene (1-525aa) is amplified by PCR from M. jannaschii genomic DNA using specific primers that introduce appropriate restriction sites, similar to methods used for other M. jannaschii genes .

  • Vector Construction: The amplified gene is cloned into an expression vector (commonly pT7-7 for M. jannaschii proteins) with an N-terminal His-tag .

  • Expression: The recombinant plasmid is transformed into E. coli. Expression conditions typical for thermophilic proteins include:

    • Induction at OD₆₀₀ ~0.6-0.8

    • IPTG concentration: 0.1-1.0 mM

    • Post-induction growth: 4-18 hours at 20-37°C (lower temperatures often improve folding)

  • Cell Lysis: Cells are harvested and lysed using methods that preserve protein structure, often including:

    • Resuspension in Tris/PBS-based buffer

    • Addition of protease inhibitors

    • Mechanical disruption (sonication or high-pressure homogenization)

    • For transmembrane proteins like MJ0107, inclusion of appropriate detergents

  • Purification: His-tagged MJ0107 is typically purified using:

    • Ni-NTA affinity chromatography

    • Wash steps with increasing imidazole concentrations

    • Elution with high imidazole (200-500 mM)

    • Buffer exchange to remove imidazole

  • Quality Control: Purity assessment by SDS-PAGE (>90% purity is typically achieved) .

  • Storage: Purified protein is stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, with recommended addition of 5-50% glycerol for long-term storage at -20°C/-80°C .

What growth conditions are required for culturing M. jannaschii?

Culturing M. jannaschii requires specialized conditions that reflect its extreme natural habitat:

  • Temperature: Optimum growth at 85°C (range: 48-94°C)

  • Pressure: Can grow at pressures up to 500 atmospheres, though atmospheric pressure is sufficient for laboratory cultivation

  • Atmosphere: Strict anaerobe requiring complete exclusion of oxygen

  • Growth Medium: Typically contains:

    • Mineral salts base

    • H₂/CO₂ (80:20) gas mixture as energy and carbon source

    • Trace minerals and vitamins

    • Reducing agents (e.g., sodium sulfide)

    • pH maintained at ~6.0-7.0

  • Culture Vessels: Specialized pressure-resistant vessels for optimal growth, though standard anaerobic techniques can be used at atmospheric pressure

  • Growth Rate: Under optimal conditions, M. jannaschii has a doubling time of approximately 26 minutes, significantly faster than many other methanogens

  • Cultivation Methods: Can be maintained as active cultures or preserved as stocks at -80°C. For genetic studies, solidified media can be used, with colonies forming in 3-4 days

The extreme growth conditions required for M. jannaschii explain why heterologous expression in E. coli is the preferred method for producing proteins like MJ0107.

What challenges arise when working with proteins from hyperthermophilic archaea?

Working with proteins from hyperthermophilic archaea like M. jannaschii presents several unique challenges:

  • Heterologous Expression Issues:

    • Codon bias differences between E. coli and M. jannaschii

    • Potential toxicity of archaeal membrane proteins to E. coli

    • Improper folding at lower expression temperatures

    • Absence of archaeal-specific chaperones and post-translational modification systems

  • Biochemical Characterization Challenges:

    • Optimal enzymatic activity often occurs at 80-90°C, requiring specialized equipment

    • Standard assay components may degrade at these temperatures

    • Buffer stability issues at high temperatures

    • Potential requirement for high pressure for native conformation

  • Structural Biology Complications:

    • Proteins may adopt different conformations at room temperature versus their physiological temperature

    • Crystal formation conditions differ from mesophilic proteins

    • Membrane proteins like MJ0107 have additional crystallization challenges

  • Functional Analysis Limitations:

    • Limited genetic tools for in vivo studies in the native organism

    • Difficult to determine physiological partners and substrates

    • Potential requirement for archaeal lipids or cofactors not present in model systems

  • Stability Paradox:

    • While stable at high temperatures, hyperthermophilic proteins may be unstable at room temperature

    • Maintaining protein integrity during purification at lower temperatures can be problematic

    • Storage conditions must prevent denaturation while avoiding repeated freeze-thaw cycles

Despite these challenges, the study of hyperthermophilic proteins offers valuable insights into protein stability, enzyme catalysis at extreme conditions, and archaeal biochemistry.

Which bioinformatic approaches are most effective for predicting MJ0107 function?

Predicting the function of uncharacterized proteins like MJ0107 requires an integrated bioinformatics approach:

  • Sequence-Based Analysis:

    • BLAST searches against characterized proteins (standard and position-specific iterative)

    • Hidden Markov Model (HMM) searches using more sensitive tools like HMMER

    • Analysis of conserved motifs using PROSITE or PRINTS

    • Transmembrane domain prediction using TMHMM or TOPCONS

  • Structural Prediction and Analysis:

    • Secondary structure prediction (PSIPRED, JPred)

    • Tertiary structure prediction using AlphaFold or I-TASSER

    • Comparison with structural databases using DALI or VAST

    • Active site prediction using CASTp or 3DLigandSite

  • Genomic Context Analysis:

    • Gene neighborhood conservation across archaeal genomes

    • Operon structure prediction

    • Co-expression patterns from available transcriptomic data

    • Phylogenetic profiling (presence/absence patterns across species)

  • Integrative Approaches:

    • Protein-protein interaction prediction using STRING

    • Metabolic pathway gap analysis to identify "missing" functions

    • Gene ontology term prediction

For transmembrane proteins like MJ0107, specialized tools that account for membrane-associated features are particularly important. The M. jannaschii genome contains numerous uncharacterized genes , and comparative analysis with recently sequenced archaeal genomes may provide additional context beyond what was available when the genome was first sequenced.

Initial analyses should focus on identifying archaeal-specific patterns, as standard tools based primarily on bacterial and eukaryotic data may miss important archaeal-specific functions.

How do expression conditions in E. coli affect the properties of recombinant MJ0107?

Expression of M. jannaschii MJ0107 in E. coli introduces several factors that can affect the final protein properties:

  • Temperature Effects:

    • M. jannaschii proteins naturally fold at ~85°C versus E. coli's 37°C

    • Lower expression temperatures (15-30°C) often improve folding but reduce yield

    • Temperature-dependent differences in chaperone availability and activity

  • Codon Usage Optimization:

    • M. jannaschii has different codon bias than E. coli

    • Rare codons in E. coli can cause translational pauses affecting folding

    • Expression yields can be improved by:

      • Using codon-optimized synthetic genes

      • Employing E. coli strains with additional tRNAs for rare codons

  • Membrane Integration Challenges:

    • E. coli membranes contain ester-linked phospholipids versus M. jannaschii's ether-linked lipids

    • Different membrane insertion machinery may affect topology

    • Archaeal transmembrane domains may not properly integrate into bacterial membranes

  • Post-Translational Modifications:

    • Archaeal-specific modifications will be absent

    • Potential inappropriate modifications by E. coli systems

    • Lack of archaeal-specific partners for complex formation

  • Protein Solubility and Stability:

    • Often requires fusion partners (MBP, SUMO, etc.) to enhance solubility

    • May form inclusion bodies requiring refolding

    • For membrane proteins like MJ0107, detergent selection is critical

  • Metal Ion and Cofactor Incorporation:

    • Different availability of metal ions and cofactors in E. coli

    • Potential requirement for supplementation during expression

Strategies to mitigate these issues include using specialized E. coli strains, co-expression with archaeal chaperones, and careful optimization of induction conditions. For MJ0107 specifically, its transmembrane nature may require screening different detergents for extraction and testing various membrane-mimetic environments to maintain native-like structure.

What structural analyses have been performed or predicted for MJ0107?

While the search results don't provide specific structural data for MJ0107, we can outline the approaches that would typically be used for structural characterization of such a protein:

  • Computational Structure Prediction:

    • Modern tools like AlphaFold would likely predict a structure with reasonable confidence

    • Transmembrane topology prediction would identify membrane-spanning regions

    • Domain identification tools would parse potential functional domains

  • Secondary Structure Analysis:

    • Circular dichroism (CD) spectroscopy could determine alpha-helix and beta-sheet content

    • FTIR spectroscopy might provide additional secondary structure information at high temperatures

  • Biophysical Characterization:

    • Size exclusion chromatography to determine oligomeric state

    • Dynamic light scattering for size distribution and aggregation tendency

    • Thermal stability assessment using differential scanning calorimetry

  • Experimental Structure Determination Challenges:

    • As a transmembrane protein, MJ0107 would present challenges for crystallization

    • Detergent selection would be critical for maintaining native structure

    • High-temperature stability might actually facilitate some structural studies

For a more complete structural understanding, MJ0107 would ideally be studied using:

  • X-ray crystallography in lipidic cubic phase

  • Cryo-electron microscopy in nanodiscs or detergent micelles

  • NMR spectroscopy for dynamic regions

The 525-amino acid length of MJ0107 suggests it might have multiple domains or a complex transmembrane topology. Structural comparisons with proteins of known function, even with low sequence similarity, could provide functional insights through structural homology that sequence-based methods might miss.

What experimental approaches have successfully characterized other uncharacterized proteins from M. jannaschii?

Several successful experimental approaches have been used to characterize previously uncharacterized M. jannaschii proteins:

  • Heterologous Expression and Purification:

    • The MJ-FprA protein (Mj_0748) was successfully expressed with affinity tags and purified from recombinant E. coli

    • MJ0107 is similarly available as a His-tagged recombinant protein expressed in E. coli

  • Genetic System Development:

    • A genetic system for M. jannaschii has been established, allowing chromosomal modifications

    • Suicide vectors enabling homologous recombination through heat shock transformation have been developed

    • Mevinolin and simvastatin serve as selection markers for transformants

  • Functional Screening Approaches:

    • Testing for predicted enzymatic activities based on pathway gap analysis

    • Example: MJ0044 was tested for phosphomevalonate kinase activity but instead found to phosphorylate isopentenyl phosphate

    • Similarly, MJ1176 (PAN) was characterized as a proteasome-activating nucleotidase

  • Homologous Overexpression:

    • Using engineered promoters like P-flaB1B2 to overexpress native proteins

    • Addition of affinity tags for purification directly from M. jannaschii

  • Biochemical Characterization:

    • M. jannaschii DNA ligase has been characterized for ATP-dependence, metal ion requirements, and pH optima

    • Activity assays optimized for high temperatures (60-85°C)

  • Pathway Reconstruction:

    • Analysis of ribose-5-phosphate biosynthesis revealed M. jannaschii uses the ribulose monophosphate pathway rather than the pentose phosphate pathway

    • Such approaches identify the metabolic context of previously uncharacterized enzymes

For MJ0107 specifically, these approaches could be combined with its predicted transmembrane nature to investigate potential roles in membrane transport, signaling, or structural functions within the unique archaeal membrane.

What methods are effective for assessing and optimizing the thermostability of hyperthermophilic proteins like MJ0107?

Analyzing and optimizing the thermostability of hyperthermophilic proteins like MJ0107 requires specialized approaches:

  • Thermal Stability Assessment Methods:

    MethodPrincipleAdvantagesLimitations
    Differential Scanning Calorimetry (DSC)Measures heat changes during unfoldingDirect measurement of TmRequires pure protein, larger amounts
    Circular Dichroism (CD)Tracks secondary structure changesLow sample requirementLess quantitative than DSC
    Thermal Shift AssaysFluorescent dye binding to exposed hydrophobic regionsHigh-throughput screeningMay not work with all proteins
    Activity Retention AssaysMeasuring residual activity after thermal treatmentFunctionally relevantRequires known activity
    Intrinsic FluorescenceMonitors tryptophan/tyrosine environment changesLabel-freeLimited to proteins with suitable residues
  • Stability Optimization Strategies:

    a) Buffer Optimization:

    • Screening various pH values (typically higher pH for thermophiles)

    • Testing stabilizing additives (e.g., glycerol, trehalose, specific ions)

    • Including archaeal lipids or lipid-like molecules for membrane proteins

    b) Protein Engineering:

    • Introducing additional salt bridges or disulfide bonds

    • Enhancing hydrophobic core packing

    • Reducing surface entropy through lysine/glutamate substitutions

    • Stabilizing α-helices through terminal capping

    c) Computational Prediction:

    • Using algorithms like CUPSAT or FoldX to predict stabilizing mutations

    • Molecular dynamics simulations at high temperatures to identify flexible regions

  • Special Considerations for MJ0107:

    • As a transmembrane protein, stability in detergent/membrane environments must be assessed

    • The native thermostability may already be optimized for 85°C

    • Storage stability at lower temperatures may be more problematic than high-temperature function

M. jannaschii proteins like MJ0107 are valuable models for understanding the molecular basis of thermostability, with applications in protein engineering and biotechnology. The thermostable properties of these proteins can actually simplify some experimental procedures, as they remain stable during typical handling procedures that might denature mesophilic proteins.

What challenges and strategies exist for determining the in vivo function of MJ0107?

Determining the in vivo function of MJ0107 involves navigating several challenges specific to M. jannaschii research:

  • Technical Challenges:

    • Growth requirements: Anaerobic conditions, high temperature (85°C), potentially high pressure

    • Lower transformation efficiency compared to model organisms

    • Limited selection markers (primarily mevinolin and simvastatin)

    • Potential essentiality of MJ0107, complicating knockout studies

    • Unknown phenotypes to screen for when manipulating MJ0107

  • Genetic Manipulation Approaches:

    • Recent development of suicide vectors for M. jannaschii enables homologous recombination

    • Heat shock-based transformation methods have proven effective

    • Engineered promoters (P-flaB1B2) allow controlled expression

    • Affinity tagging for protein localization and interaction studies

  • Functional Investigation Strategies:

    a) Gene Deletion or Disruption:

    • Create MJ0107 knockout using homologous recombination

    • Assess phenotypic changes in growth, morphology, stress response

    • If essential, use conditional approaches (controllable promoters)

    b) Protein Localization:

    • Tag MJ0107 with affinity or fluorescent tags

    • Determine subcellular localization within M. jannaschii

    • For membrane proteins, specific localization patterns may suggest function

    c) Interactome Analysis:

    • Identify protein interaction partners in vivo

    • Cross-linking followed by affinity purification and mass spectrometry

    • Reciprocal tagging of potential partners to confirm interactions

    d) Transcriptional Profiling:

    • Analyze conditions that alter MJ0107 expression

    • Identify co-regulated genes suggesting functional relationships

    e) Metabolomic Analysis:

    • Compare metabolite profiles between wild-type and MJ0107 mutants

    • May reveal pathway disruptions indicating function

The genetic system for M. jannaschii described in the literature provides promising avenues for in vivo characterization of MJ0107. The recent demonstration that chromosomal modifications can be achieved through homologous recombination with exogenous DNA is particularly valuable for studying uncharacterized genes like MJ0107 in their native context.

How can cross-species complementation studies be designed to investigate MJ0107 function?

Cross-species complementation offers a powerful approach to investigate MJ0107 function by determining if it can rescue phenotypes in other organisms with mutations in functionally related genes:

  • Target System Selection:

    • Model archaea with better-developed genetic tools (e.g., Thermococcus kodakarensis)

    • Related methanogens with established genetic systems (e.g., Methanosarcina)

    • Bacteria with well-characterized membrane protein functions

    • Yeast systems for eukaryotic complementation studies

  • Identification of Potential Functional Homologs:

    • Sensitive sequence comparison tools (PSI-BLAST, HHpred)

    • Structural prediction comparisons even in absence of sequence similarity

    • Genomic context comparison across species

    • Transmembrane topology pattern matching

  • Expression Vector Design:

    • Codon optimization for the host organism

    • Temperature-appropriate promoters (considering MJ0107's adaptation to 85°C)

    • For transmembrane proteins: appropriate signal sequences or membrane targeting

    • Addition of tags that don't interfere with function

    • Inducible expression systems to control toxicity

  • Complementation Testing Approaches:

    ApproachMethodologyAdvantagesLimitations
    Gene knockout rescueExpress MJ0107 in deletion strainsDirect functional testRequires identifiable homolog
    Conditional mutant rescueExpress under restrictive conditionsWorks for essential genesMore complex setup
    Stress sensitivity rescueTest if MJ0107 restores stress toleranceCan suggest function when direct homolog unknownIndirect evidence
    Domain swappingCreate chimeric proteinsIdentifies functional domainsComplex construct design
  • Verification Methods:

    • Confirm proper expression and localization

    • Western blotting, fluorescence microscopy

    • Membrane fraction isolation

    • Quantitative phenotype assays

  • Special Considerations for MJ0107:

    • Temperature adaptation (host maximum temperature vs. M. jannaschii's 85°C optimum)

    • Archaeal vs. bacterial/eukaryotic membrane differences

    • Potential requirement for archaeal-specific lipids or cofactors

If successful, complementation studies would not only suggest function but also demonstrate remarkable conservation of protein function across vast evolutionary distances, potentially revealing universal aspects of membrane protein biology.

What are the evolutionary implications of studying MJ0107 from a deeply branching archaeon?

Studying MJ0107 from M. jannaschii, a deeply branching archaeon, provides unique opportunities for evolutionary insights:

  • Archaeal Protein Evolution Analysis:

    • M. jannaschii was the first archaeon sequenced, revealing many novel proteins and metabolic features

    • Its phylogenetic position makes it valuable for studying early divergence in the archaeal domain

    • MJ0107, as an uncharacterized protein, may represent archaeal-specific innovations

  • Phylogenetic Distribution Patterns:

    • Homolog presence/absence across archaea, bacteria, and eukaryotes

    • If broadly conserved in archaea but absent in other domains: likely ancient archaeal protein

    • If restricted to methanogens or hyperthermophiles: potential adaptation to these lifestyles

    • If found across domains: possible horizontal gene transfer or presence in LUCA (Last Universal Common Ancestor)

  • Structural Conservation vs. Sequence Divergence:

    • Proteins may maintain structural and functional conservation despite low sequence identity

    • Example: MJ0757 was initially misidentified as a thymidylate synthase homolog based on limited sequence conservation, but detailed structural analysis rejected this relationship

    • This highlights the importance of combining sequence and structural approaches for ancient proteins

  • Archaeal Membrane Adaptations:

    • As a potential transmembrane protein, MJ0107 may reveal adaptations to archaeal membrane structure

    • Archaeal membranes differ fundamentally from bacterial/eukaryotic membranes (ether- vs. ester-linked lipids)

    • Functions in hyperthermophilic membranes require special adaptations for fluidity at high temperatures

  • Reconstruction of Ancient Metabolic Pathways:

    • M. jannaschii uses modified versions of some conserved pathways:

      • Modified mevalonate pathway for isoprenoid synthesis

      • Ribulose monophosphate pathway rather than pentose phosphate pathway for ribose-5-phosphate synthesis

    • MJ0107 may similarly represent a divergent version of a conserved function

The search results indicate that M. jannaschii has many novel metabolic features with significant portions of its genome encoding proteins of unknown function . This suggests that proteins like MJ0107 could be involved in archaeal-specific processes that differ from those in bacteria and eukaryotes, potentially offering insights into the unique evolutionary trajectory of the archaeal domain.

What adaptations are needed for structural biology techniques to study MJ0107 under native-like conditions?

Studying the structure of MJ0107 under conditions that mimic its native hyperthermophilic environment requires specialized adaptations across various structural biology techniques:

  • X-ray Crystallography Adaptations:

    • Crystallization at elevated temperatures (50-70°C) using thermostable plates

    • Inclusion of archaeal lipids or specialized detergents for membrane protein stabilization

    • High-pressure crystallization techniques to mimic deep-sea conditions

    • Temperature-controlled systems during crystal mounting and data collection

    • Careful cryoprotection protocols to prevent structural artifacts

  • Nuclear Magnetic Resonance (NMR) Modifications:

    • Variable temperature NMR probes for measurements at 60-85°C

    • Pressure-resistant NMR tubes for high-pressure studies

    • Special pulse sequences optimized for high temperatures

    • Nanodiscs incorporating archaeal lipid analogs for membrane protein studies

    • Deuteration strategies to simplify spectra of large proteins

  • Cryo-Electron Microscopy (cryo-EM) Considerations:

    • Sample preparation techniques that capture high-temperature conformations

    • High-pressure freezing to mimic native pressure conditions

    • Archaeal lipid nanodiscs or reconstituted vesicles for membrane environment

    • Computational approaches to distinguish between conformational states

    • Vitrification optimization to preserve native structure

  • Small-Angle X-ray/Neutron Scattering Approaches:

    • High-temperature sample cells with precise temperature control

    • Pressure-resistant sample holders for combined high-temperature/high-pressure studies

    • Contrast variation with deuterated components to highlight specific protein regions

    • Time-resolved studies to capture dynamics at physiological temperatures

  • Computational Integration and Validation:

    • Molecular dynamics simulations at elevated temperatures and pressures

    • Integration of experimental data from multiple techniques

    • Validation using biochemical assays performed under native-like conditions

    • Comparison with structures of homologous proteins from mesophilic organisms

What considerations apply when designing genetic modification systems for studying proteins like MJ0107 in M. jannaschii?

Designing genetic systems for M. jannaschii to study proteins like MJ0107 requires specialized considerations for the extreme growth conditions and unique biology of this archaeon:

  • Vector and Construct Design:

    • Suicide vectors for homologous recombination as described for M. jannaschii

    • Linear DNA transformation rather than circular plasmids to avoid merodiploid formation

    • Inclusion of thermostable selectable markers (e.g., mevinolin/simvastatin resistance)

    • Use of flanking homology regions (≥500 bp) for efficient recombination

    • Codon optimization for M. jannaschii's AT-rich genome

  • Transformation Methods:

    • Heat shock-based transformation rather than chemical transformation

    • Optimization of DNA protection during transformation at high temperatures

    • DNA methylation considerations to avoid potential restriction barriers

  • Selection and Screening:

    • Limited selection markers available for archaea

    • Mevinolin and simvastatin have been successful for M. jannaschii

    • PCR-based screening strategies for identifying recombinants

    • Development of reporter systems functioning at high temperatures

  • Expression Systems:

    • Engineered thermostable promoters like P-flaB1B2

    • Controllable/inducible promoter systems for conditional expression

    • Affinity tag systems that function at high temperatures

  • Genome Editing Strategies:

    • Double crossover homologous recombination for gene replacement

    • Markerless deletion systems for studying essential genes

    • Modification rather than deletion (e.g., point mutations, tag insertion)

  • CRISPR/Cas Adaptation Considerations:

    • Thermostable Cas variants from thermophilic organisms

    • Guide RNA stability at high temperatures

    • Delivery methods compatible with M. jannaschii

  • Phenotypic Analysis:

    • High-temperature compatible assays

    • Methods to assess protein localization, interaction, or function under anaerobic, high-temperature conditions

Recent advances in genetic tools for M. jannaschii demonstrate feasibility despite challenging growth conditions. The search results describe successful generation of genomic modifications including gene replacements and tagged protein expression . These tools enable targeted studies of proteins like MJ0107 in their native context, allowing determination of subcellular localization, interaction partners, and phenotypic consequences of modification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.