Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0129 (MJ0129)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
MJ0129; Uncharacterized protein MJ0129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0129
Target Protein Sequence
MLSFVVMSFLIFVIVMVNEHKAHLSVIQKMILAVVNGSITIILSIIVFYIFYPQNISLFL ITAGILTVFVFLYGLLLFLFGFTHRELSYLSKYDKYKFLCKFTIEMFSSLTNHAFLTISA IVLYQIQHPKPTIDFIVMIGMITISVIVVMLLFLKTYSIIIKQLKKLENN
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0129

STRING: 243232.MJ_0129

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are used for producing recombinant MJ0129?

Recombinant MJ0129 is typically expressed in E. coli expression systems. According to product specifications, the full-length protein (residues 1-170) is produced with an N-terminal His-tag to facilitate purification. This approach allows for efficient protein production and subsequent purification steps that yield protein with greater than 90% purity as determined by SDS-PAGE analysis .

The recombinant expression strategy provides consistent protein yields suitable for various downstream applications including structural studies, functional assays, and biochemical characterization. The E. coli expression system balances the need for high protein yields with the practical considerations of laboratory-scale protein production for research purposes.

What are the optimal storage and handling conditions for recombinant MJ0129?

For maintaining optimal stability and functionality of recombinant MJ0129, the following storage and handling guidelines should be followed:

ParameterRecommendation
Storage temperature-20°C/-80°C upon receipt
FormLyophilized powder
Reconstitution methodBriefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0
Long-term storageAdd 5-50% glycerol (final concentration) and aliquot
Short-term storageWorking aliquots at 4°C for up to one week
Important considerationsAvoid repeated freeze-thaw cycles; aliquoting is necessary for multiple use

These storage conditions are critical for maintaining protein integrity and activity, particularly given the challenges associated with handling proteins from extremophilic organisms that may have unique stability requirements .

What structural characterization methods are most appropriate for MJ0129?

Due to the predicted membrane-associated nature of MJ0129, researchers should consider multiple complementary structural characterization approaches:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure elements and can assess thermal stability across temperature ranges relevant to thermophilic organisms.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For a protein of this size (170 amino acids), solution NMR can provide valuable structural insights, especially when coupled with appropriate membrane mimetics.

  • X-ray Crystallography: Though challenging for membrane proteins, this approach can yield high-resolution structural data if appropriate crystallization conditions are identified.

  • Cryo-Electron Microscopy: Particularly useful if MJ0129 forms higher-order assemblies or complexes within membrane environments.

  • Molecular Dynamics Simulations: Can complement experimental data by predicting membrane orientation and lipid interactions based on sequence characteristics.

A strategic approach would begin with preliminary biophysical characterization (CD spectroscopy) to confirm proper folding before proceeding to more resource-intensive techniques. For membrane proteins like MJ0129, special consideration must be given to the lipid or detergent environment used during structural studies.

How can researchers address contradictory data when studying MJ0129 function?

When encountering contradictory results in MJ0129 functional studies, researchers should implement the following systematic approach:

  • Classify contradiction types:

    • Type 1: Different output values despite identical input conditions

    • Type 2: Similar output values despite different experimental conditions

  • Statistical validation:

    • Apply chi-square tests to evaluate variable independence (test statistic threshold >600 indicates strong variable dependence)

    • Implement ANOVA to identify significant contributing factors

    • Consider whether outliers should be retained or removed based on experimental context

  • Experimental validation:

    • Increase technical and biological replicates to strengthen statistical power

    • Employ orthogonal methodologies to cross-validate findings

    • Document all metadata associated with experiments showing contradictory results

  • Data modeling approaches:

    • Consider developing rule-based models that can accommodate contradictory data

    • Identify threshold values where experimental outcomes diverge

    • Implement machine learning approaches to identify hidden variables

This systematic approach ensures scientific rigor while acknowledging the inherent complexity of working with uncharacterized proteins from extremophilic organisms .

What controls should be included in functional assays involving MJ0129?

Robust experimental design for MJ0129 functional characterization requires a comprehensive set of controls:

Control TypeDescriptionPurpose
Negative expression controlE. coli containing empty vector processed identicallyControls for host cell contaminants and non-specific effects
Tag-only controlHis-tag peptide aloneAssesses potential tag interference with experimental readouts
Heat-denatured MJ0129Sample heated to ensure complete denaturationControls for non-specific binding or activity
Buffer controlReconstitution buffer without proteinAccounts for buffer component effects
Related protein controlSimilar membrane protein from Methanocaldococcus jannaschiiEstablishes specificity of observed effects
Loading/concentration controlsSerial dilutions of proteinEnsures linearity of response in quantitative assays

Each control should be subjected to identical experimental conditions and analyzed using the same methodologies as the test samples. Inclusion of these controls is essential for differentiating true functional characteristics from experimental artifacts .

What experimental approaches can elucidate the membrane-associated properties of MJ0129?

To investigate the predicted membrane-associated properties of MJ0129, researchers should consider these methodological approaches:

  • Membrane localization studies:

    • Fluorescently tagged constructs for in vivo localization

    • Subcellular fractionation followed by immunoblotting

    • Protease protection assays to determine topology

  • Reconstitution systems:

    • Liposomes composed of archaeal lipids or synthetic alternatives

    • Nanodiscs for single-molecule studies

    • Planar lipid bilayers for electrophysiological measurements

  • Biophysical characterization in membrane mimetics:

    • Detergent screening (DDM, LDAO, etc.) for optimal solubilization

    • Assessment of protein stability using differential scanning fluorimetry

    • Evaluation of oligomeric state using native PAGE and size exclusion chromatography

  • Functional assays:

    • Ion flux measurements if channel/transporter function is suspected

    • Binding assays with potential ligands

    • Assessment of lipid-modifying activities

These approaches should be implemented systematically, with careful attention to the unique physicochemical properties of archaeal membrane proteins, particularly those from hyperthermophilic organisms.

What computational tools are recommended for sequence and structural analysis of MJ0129?

For comprehensive computational analysis of MJ0129, researchers should employ a multi-tiered approach:

  • Primary sequence analysis:

    • TMHMM/MEMSAT for transmembrane domain prediction

    • SignalP for signal peptide identification

    • PSIPRED for secondary structure prediction

    • Multiple sequence alignment with homologous proteins from diverse archaea

  • Structural prediction:

    • AlphaFold2 for tertiary structure prediction

    • SWISS-MODEL for homology modeling if suitable templates exist

    • Molecular dynamics simulations to assess stability in membrane environments

  • Functional prediction:

    • InterProScan for domain and motif identification

    • ConSurf for evolutionary conservation analysis

    • Protein-protein interaction prediction using STRING database

  • Integrated analysis workflows:

    • Galaxy platform for reproducible bioinformatics pipelines

    • Jupyter notebooks for documentation and sharing of analytical methods

    • R/Bioconductor for statistical analysis of experimental data

These computational approaches provide a foundation for hypothesis generation regarding MJ0129 function and can guide subsequent experimental designs for validation.

How should researchers approach expression optimization for challenging archaeal proteins like MJ0129?

Optimizing expression of archaeal membrane proteins requires systematic evaluation of multiple variables:

  • Expression vector selection:

    • Consider codon optimization for E. coli expression

    • Evaluate multiple promoter strengths (T7, tac, araBAD)

    • Test various fusion tags beyond His-tag (MBP, SUMO, Trx)

  • Host strain optimization:

    • C41/C43(DE3) strains specialized for membrane protein expression

    • Rosetta strains for rare codon optimization

    • SHuffle strains if disulfide bonds are present

  • Induction conditions matrix:

    • Temperature range: 15-37°C

    • Inducer concentration: 0.1-1.0 mM IPTG or equivalent

    • Induction duration: 4-24 hours

    • Media formulations: LB, TB, auto-induction media

  • Solubilization screening:

    • Test panel of detergents at various concentrations

    • Evaluate solubilization efficiency via Western blotting

    • Assess protein activity following solubilization

  • Purification optimization:

    • Buffer composition variations (pH 6.0-8.5)

    • Salt concentration ranges (150-500 mM)

    • Addition of stabilizing agents (glycerol, specific lipids)

Systematic evaluation of these parameters using design of experiments (DoE) approaches can significantly improve yields of functional archaeal membrane proteins like MJ0129.

What are the potential functional roles of MJ0129 based on sequence analysis?

Based on sequence characteristics, MJ0129 may function in one of several capacities:

  • Membrane transport: The multiple hydrophobic regions suggest potential involvement in small molecule or ion transport across the archaeal cell membrane.

  • Signal transduction: The protein could function as a receptor or component of a signal transduction pathway, particularly if it spans the membrane multiple times.

  • Membrane anchoring: MJ0129 might serve as an anchoring protein for larger protein complexes involved in critical cellular processes.

  • Metabolic functions: Given the extreme environment inhabited by M. jannaschii, the protein could be involved in specialized metabolic pathways unique to hyperthermophilic archaea.

  • Structural role: The protein may contribute to membrane stability under extreme temperature conditions characteristic of M. jannaschii's natural habitat.

Experimental validation is required to distinguish between these potential functions, likely beginning with localization studies and protein-protein interaction analyses.

How can researchers design experiments to investigate temperature-dependent properties of MJ0129?

Given that M. jannaschii is a hyperthermophile with an optimal growth temperature around 85°C, investigating the temperature-dependent properties of MJ0129 requires specialized approaches:

  • Thermal stability assessment:

    • Differential scanning calorimetry across 30-100°C range

    • Circular dichroism spectroscopy with temperature ramping

    • Thermofluor assays to identify stabilizing buffer conditions

  • Activity measurements at elevated temperatures:

    • Design assay systems that remain stable at high temperatures

    • Implement real-time monitoring to capture transient activities

    • Compare activity profiles at mesophilic vs. thermophilic temperatures

  • Structural characterization across temperature range:

    • NMR studies at various temperatures to detect conformational changes

    • Hydrogen-deuterium exchange mass spectrometry at different temperatures

    • Molecular dynamics simulations across temperature ranges

  • Comparative studies with mesophilic homologs:

    • Identify closest homologs from mesophilic archaea or bacteria

    • Compare stability, activity, and structural features

    • Perform domain-swapping experiments to identify thermostabilizing regions

These experimental approaches can provide insights into adaptations that enable protein function at extreme temperatures, potentially revealing principles applicable to protein engineering and biotechnology applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.