Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0131 (MJ0131)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ0131; Uncharacterized protein MJ0131
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0131
Target Protein Sequence
MPGVIFWTIFIIQFMIWVFLSTTKIGRVIAFIWGTMPFLALYLKYTGYFPTIFENPDVNL FANLLSNFVVEWSYLVVQTTVPSWIGLLFGLKLSGNNDTPQII
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0131

STRING: 243232.MJ_0131

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it scientifically significant?

Methanocaldococcus jannaschii (formerly known as Methanococcus jannaschii) is a hyperthermophilic methanogenic archaeon originally isolated from a "white smoker" chimney at a depth of 2600 meters in the East Pacific Rise near the western coast of Mexico. The organism is scientifically significant as it represents extremophile adaptation to high temperature, high pressure, and moderate salinity environments . M. jannaschii cells are irregular cocci with polar bundles of flagella, and their cell envelope consists of a cytoplasmic membrane and a protein surface layer . As an archaeon, M. jannaschii provides important insights into the early evolution of life and the molecular basis for the diversification of cellular life . Its complete genome sequence of 1.66-megabase pairs has been determined, consisting of a large circular chromosome and two extrachromosomal elements, which has greatly advanced our understanding of archaeal biology .

What are the basic structural characteristics of the MJ0131 protein?

MJ0131 is a full-length uncharacterized protein from Methanocaldococcus jannaschii consisting of 103 amino acids . The protein is available in recombinant form with a His-tag, typically expressed in E. coli expression systems . As an uncharacterized protein, its three-dimensional structure has not been fully determined, though structural prediction methods may provide insights into its potential fold and functional domains. The relatively small size (103 amino acids) suggests it may function as part of a larger complex or have a specialized role rather than serve as a large enzymatic protein. For research purposes, understanding that its His-tagged version allows for easy purification using affinity chromatography is particularly important for downstream structural and functional studies.

What is known about the genomic context of the MJ0131 gene in M. jannaschii?

The MJ0131 gene is located within the M. jannaschii genome, which has been completely sequenced and consists of a large circular chromosome and two extrachromosomal elements (ECEs) . While specific information about the genomic neighborhood of MJ0131 is limited in the provided search results, researchers should examine the intergenic segments surrounding this open reading frame (ORF) for potential regulatory elements that might control its expression . The complete genome sequence of M. jannaschii is available (identified as SEQ ID NO: 1, SEQ ID NO:2, and SEQ ID NO:3 in patent documentation), providing a resource for analyzing the genetic context of MJ0131 . Examining nearby genes may provide clues about potential functional relationships, operonic structures, or co-regulated gene clusters that could inform hypotheses about MJ0131's function.

What computational methods can predict the potential function of the uncharacterized protein MJ0131?

Several computational approaches can be employed to predict the potential function of uncharacterized proteins like MJ0131:

  • Structure-based function prediction: This approach compares predicted binding sites to libraries of known structures. Tools like ProBiS can be used to construct models with potential ligands and validate them through molecular dynamics simulations . This method is particularly valuable when sequence homology fails to identify related proteins with known functions.

  • Binding site analysis: Examining structurally conserved binding sites can provide insights into protein function, especially when conventional homology methods are unsuccessful . For MJ0131, researchers should look for similarities with nucleotide binding sites or other conserved functional domains.

  • Molecular dynamics validation: After generating a model with a potential ligand, molecular dynamics simulations can validate the stability of the interaction and calculate binding free energies . This approach helped identify Tm1631 from Thermotoga maritima as a potential DNA binding enzyme with endonuclease activity, and similar approaches could be applied to MJ0131.

  • Genomic context analysis: Examining neighboring genes in the M. jannaschii genome may reveal functional associations through operonic structures or related metabolic pathways .

These computational methods should be used complementarily to generate testable hypotheses about MJ0131's function that can then be validated experimentally.

How can researchers experimentally determine the function of uncharacterized proteins like MJ0131?

Experimental determination of uncharacterized protein function requires a multi-faceted approach:

  • Recombinant protein expression and purification: Using the recombinant His-tagged MJ0131 protein expressed in E. coli provides purified material for downstream functional assays . Optimization of expression conditions may be necessary given the thermophilic origin of this protein.

  • Biochemical activity assays: Based on computational predictions, design assays to test specific hypotheses about function. If binding site analysis suggests nucleotide binding capability, assess DNA/RNA binding through gel shift assays, fluorescence anisotropy, or surface plasmon resonance .

  • Structural characterization: X-ray crystallography, NMR spectroscopy, or cryo-EM can provide structural insights that inform function. For smaller proteins like MJ0131 (103 amino acids), NMR may be particularly suitable .

  • Protein-protein interaction studies: Techniques like pull-down assays, co-immunoprecipitation, or yeast two-hybrid screens can identify interaction partners, providing functional context .

  • Gene knockout/complementation studies: Though challenging in archaea, CRISPR-Cas9 systems adapted for M. jannaschii could enable creation of MJ0131 deletion strains to observe phenotypic effects.

  • Heterologous expression systems: Express MJ0131 in model organisms under various stress conditions to observe phenotypic effects that might suggest function .

  • Comparative analysis with homologs: If structural homologs are identified in other extremophiles, their characterized functions may provide clues about MJ0131's role .

This systematic approach increases the likelihood of successfully characterizing this uncharacterized archaeal protein.

What growth conditions are optimal for studying M. jannaschii proteins in their native context?

When studying M. jannaschii proteins in their native context, researchers must recreate the extreme conditions of the organism's natural habitat. M. jannaschii is a hyperthermophilic methanogenic archaeon that thrives in high-temperature, high-pressure environments with moderate salinity . Optimal growth conditions should include:

  • Temperature: Growth at approximately 85°C to mimic the hydrothermal vent environment from which M. jannaschii was isolated . Temperature-controlled bioreactors are essential for maintaining these elevated temperatures.

  • Pressure: Cultivation under high pressure (approximately 200-260 atmospheres) to simulate the deep-sea conditions at 2600 meters depth where the organism was discovered . Specialized pressure vessels or hyperbaric chambers designed for microbial cultivation are required.

  • Media composition: Methanogenic growth medium containing carbonate buffer, suitable nitrogen sources, trace minerals, and reducing agents to maintain anaerobic conditions . The medium should contain moderate salinity to reflect the marine origin of the organism.

  • Atmosphere: Strictly anaerobic conditions with a H₂/CO₂ gas mixture (typically 80:20) as M. jannaschii is a strict anaerobe that uses hydrogen as an electron donor and carbon dioxide as a carbon source for methanogenesis .

  • pH: Slightly acidic to neutral pH (approximately 6.0-7.0) to optimize growth and protein stability.

These specialized growth requirements present significant technical challenges for studying M. jannaschii proteins in their native context, which is why many researchers opt for recombinant expression of target proteins like MJ0131 in mesophilic hosts like E. coli for initial characterization .

How might protein MJ0131's structure relate to its adaptation to extreme environments?

The structure of MJ0131 likely reflects adaptations to the extreme conditions in which M. jannaschii thrives:

  • Thermostability features: As a protein from a hyperthermophile that grows optimally at high temperatures, MJ0131 likely incorporates structural features that enhance thermostability . These may include:

    • Increased number of salt bridges and hydrogen bonds

    • Higher proportion of charged amino acids on the surface

    • More compact hydrophobic core

    • Reduced number of thermolabile amino acids (e.g., asparagine, glutamine)

    • Shortened loop regions to reduce flexibility at high temperatures

  • Pressure adaptation: Given M. jannaschii's deep-sea habitat (2600m depth), MJ0131 may exhibit structural features that provide barostability . These could include:

    • Structural flexibility that accommodates high-pressure environments

    • Modified hydration layers

    • Specific amino acid compositions that maintain proper folding under pressure

  • Salt tolerance mechanisms: Adaptations to moderate salinity may be reflected in the protein's surface charge distribution and hydration patterns .

  • Domain architecture: While specific domain information for MJ0131 is not provided in the search results, its relatively small size (103 amino acids) suggests it may have a specialized function, possibly as part of a larger complex . This compact structure could contribute to stability under extreme conditions.

Structural studies comparing MJ0131 with homologous proteins from non-extremophilic organisms could highlight these adaptive features and provide insights into the molecular basis of extremophile adaptation.

What evolutionary insights can be gained from studying uncharacterized archaeal proteins like MJ0131?

Studying uncharacterized archaeal proteins like MJ0131 offers valuable evolutionary insights:

  • Archaeal lineage-specific innovations: Uncharacterized proteins that lack clear homologs in bacteria or eukaryotes may represent archaeal-specific adaptations or functions . MJ0131, as an uncharacterized protein, could represent a molecular innovation specific to the archaeal domain or to methanogens.

  • Ancient protein functions: Archaea, particularly those from deep-branching lineages like Methanocaldococcus, may preserve ancient protein functions that illuminate early cellular evolution . The study of MJ0131 could potentially reveal functional mechanisms that were present in the last universal common ancestor (LUCA).

  • Adaptation to extreme environments: M. jannaschii's proteins, including MJ0131, have evolved to function in extreme conditions (high temperature, high pressure, moderate salinity) . Comparative analysis with homologs from mesophilic archaea or other domains could reveal molecular mechanisms of adaptation to extreme environments.

  • Horizontal gene transfer detection: Analysis of MJ0131's sequence and structure might reveal evidence of horizontal gene transfer events between archaea and other domains, contributing to our understanding of prokaryotic genome evolution .

  • Filling gaps in the protein universe: Characterizing novel protein families like potentially MJ0131 helps complete our picture of protein diversity across all domains of life and may reveal new structural folds or biochemical functions .

  • Reconstruction of metabolic evolution: Placing MJ0131 in its metabolic context could provide insights into the evolution of methanogenesis and other ancient metabolic pathways .

The integration of structural, functional, and phylogenetic analyses of uncharacterized proteins like MJ0131 contributes significantly to our understanding of archaeal evolution and the early diversification of cellular life.

What potential applications exist for thermostable proteins derived from M. jannaschii?

Thermostable proteins derived from hyperthermophiles like M. jannaschii have numerous potential applications in biotechnology and research:

  • Biocatalysis and industrial enzymes: Thermostable proteins can be utilized in industrial processes that operate at high temperatures, offering advantages such as increased reaction rates, reduced risk of microbial contamination, and improved substrate solubility . If MJ0131 is found to have enzymatic activity, its thermostability could make it valuable for specialized industrial applications.

  • Molecular biology reagents: Thermostable DNA and RNA processing enzymes from hyperthermophiles have revolutionized molecular biology techniques, as exemplified by the widespread use of thermostable DNA polymerases in PCR . If MJ0131 is found to interact with nucleic acids, it could potentially be developed into new research tools.

  • Structural biology models: The exceptional stability of thermophilic proteins makes them excellent candidates for structural studies, as they often crystallize more readily than mesophilic homologs . MJ0131's structure could provide insights applicable to protein engineering efforts.

  • Protein engineering templates: The structural features that confer thermostability in MJ0131 could serve as templates for engineering enhanced stability in mesophilic proteins of industrial or pharmaceutical importance .

  • Biosensors for extreme conditions: Thermostable proteins can be incorporated into biosensors designed to function in harsh environments where conventional protein-based sensors would denature.

  • Archaeal expression systems: Understanding the regulation and expression of proteins like MJ0131 contributes to the development of archaeal expression systems optimized for the production of thermostable proteins .

  • Drug discovery: Novel structural features or enzymatic mechanisms in archaeal proteins may inspire new approaches to therapeutic development, particularly for targets requiring high stability formulations.

The potential applications of MJ0131 specifically would depend on its function, which remains to be fully characterized through the approaches discussed in previous sections.

What are the challenges in expressing and purifying recombinant archaeal proteins like MJ0131 in E. coli systems?

Expressing and purifying archaeal proteins in E. coli presents several challenges:

  • Codon usage bias: Archaea and bacteria have different codon preferences, which can lead to poor translation efficiency, premature termination, or mistranslation when archaeal genes are expressed in E. coli . This can be addressed by:

    • Codon optimization of the MJ0131 gene for E. coli expression

    • Using E. coli strains with plasmids encoding rare tRNAs

    • Employing lower expression temperatures to allow proper folding

  • Protein folding issues: Thermophilic proteins often misfold at mesophilic temperatures, leading to inclusion body formation . Strategies to overcome this include:

    • Expression at higher temperatures (30-37°C)

    • Co-expression with molecular chaperones

    • Use of solubility-enhancing fusion tags beyond the His-tag (e.g., MBP, SUMO, or GST)

    • In-column refolding during purification

  • Post-translational modifications: If MJ0131 requires archaeal-specific modifications absent in E. coli, the recombinant protein may lack full functionality . This may necessitate:

    • Characterization of potential modifications in native M. jannaschii

    • Development of archaeal expression systems for authentic modification

  • Protein stability during purification: Even when successfully expressed, archaeal proteins may be unstable during purification under standard conditions . Optimization strategies include:

    • Adding stabilizing agents (glycerol, specific salts)

    • Conducting purification at higher temperatures

    • Using buffers that mimic aspects of the archaeal intracellular environment

  • Protein activity assessment: Determining if the recombinant protein is properly folded and functional requires:

    • Comparative structural analysis with predicted models

    • Activity assays under conditions mimicking the native environment

    • Thermal stability assays to confirm thermophilic properties are preserved

The commercially available recombinant His-tagged MJ0131 protein expressed in E. coli suggests that at least some of these challenges have been overcome for this specific protein , though researchers should verify its structural integrity and functional state before proceeding with characterization studies.

What structural biology techniques are most appropriate for characterizing uncharacterized proteins like MJ0131?

When characterizing uncharacterized proteins like MJ0131, several structural biology techniques offer complementary insights:

  • X-ray Crystallography: Provides high-resolution structural data if the protein can be crystallized . For MJ0131:

    • Advantages: Highest resolution potential; can capture protein-ligand complexes

    • Challenges: Requires successful crystallization; thermophilic proteins often crystallize more readily but may need specialized conditions

    • Strategy: Screen crystallization conditions at various temperatures, potentially including those that mimic M. jannaschii's native environment

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Ideal for smaller proteins like MJ0131 (103 amino acids) :

    • Advantages: Provides dynamic information; works in solution; good for detecting binding interactions

    • Challenges: Resolution decreases with increasing protein size

    • Strategy: Isotope labeling (¹⁵N, ¹³C) during recombinant expression for multidimensional NMR studies

  • Cryo-Electron Microscopy (cryo-EM): Typically used for larger proteins or complexes:

    • Advantages: No crystallization required; can visualize different conformational states

    • Challenges: Traditional limitations for small proteins like MJ0131, though technological advances are reducing this barrier

    • Strategy: Consider if MJ0131 functions in a larger complex that could be studied by cryo-EM

  • Small-Angle X-ray Scattering (SAXS): Provides low-resolution structural information in solution:

    • Advantages: No crystallization needed; can detect conformational changes upon ligand binding

    • Challenges: Limited resolution compared to crystallography or NMR

    • Strategy: Use as complementary approach to validate models from other methods

  • Computational Structure Prediction: Methods like AlphaFold2 can provide starting models:

    • Advantages: Rapidly generates structural hypotheses; no experimental protein required

    • Challenges: Validation required; may miss novel structural features

    • Strategy: Use predicted structures to guide experimental design and interpret results

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides information about protein dynamics and solvent accessibility:

    • Advantages: Can identify binding regions and conformational changes

    • Challenges: Limited spatial resolution

    • Strategy: Compare exchange patterns with and without potential binding partners

For MJ0131 specifically, a combined approach starting with computational prediction, followed by NMR (given its small size) and complemented by crystallography for high-resolution details would be most effective . The structure-based function prediction methodology described for Tm1631 provides a useful template for similar work with MJ0131 .

How can researchers design binding site prediction studies for MJ0131 based on structural data?

Designing binding site prediction studies for MJ0131 based on structural data involves several strategic steps:

  • Initial structure determination or prediction:

    • Generate a high-quality structural model of MJ0131 using experimental methods (X-ray crystallography, NMR) or computational prediction tools

    • Validate the model through energy minimization and quality assessment metrics

    • For thermostable proteins like MJ0131, consider how the native high-temperature environment might affect structure

  • Cavity and pocket identification:

    • Use computational tools such as CASTp, POCASA, or SiteMap to identify potential binding pockets on the MJ0131 structure

    • Analyze the physicochemical properties of identified cavities (hydrophobicity, electrostatic potential, conservation)

    • Prioritize cavities based on size, shape, and conservation among homologs

  • Binding site comparison to known structures:

    • Employ tools like ProBiS to compare predicted binding sites against libraries of characterized binding sites

    • Similar to the approach used for Tm1631, search for similarities with nucleotide binding sites or other functional motifs

    • Focus particularly on binding sites from other archaeal proteins or proteins with similar predicted functions

  • Conservation analysis:

    • Identify potential homologs of MJ0131 in other species

    • Perform multiple sequence alignment to determine conserved residues

    • Map conservation scores onto the structural model to identify functionally important regions that may correspond to binding sites

  • Molecular docking studies:

    • Based on binding site prediction results, select potential ligands for docking studies

    • Perform molecular docking using tools like AutoDock, GOLD, or Glide

    • Evaluate binding poses and energies to identify the most likely binding partners

  • Molecular dynamics validation:

    • Similar to the approach with Tm1631, construct models of MJ0131 with potential ligands

    • Perform molecular dynamics simulations to assess stability of the protein-ligand complex

    • Calculate binding free energies to quantify interaction strength

    • Analyze specific interactions (hydrogen bonds, salt bridges, hydrophobic contacts) that stabilize the complex

  • Experimental validation planning:

    • Design site-directed mutagenesis experiments targeting predicted binding site residues

    • Plan binding assays (fluorescence anisotropy, isothermal titration calorimetry, surface plasmon resonance) to test interaction with predicted ligands

    • Consider structural studies of MJ0131 co-crystallized with potential ligands

This systematic approach to binding site prediction can generate testable hypotheses about MJ0131's function that guide subsequent experimental characterization efforts .

How should researchers interpret evolutionary conservation patterns for uncharacterized proteins like MJ0131?

Interpreting evolutionary conservation patterns for uncharacterized proteins like MJ0131 requires a methodical approach:

  • Homolog identification across domains of life:

    • Perform sensitive sequence searches (PSI-BLAST, HMMer, HHpred) to identify distant homologs beyond obvious sequence similarity

    • Classify homologs by taxonomic distribution (archaeal-specific, conserved across domains, restricted to thermophiles, etc.)

    • The distribution pattern provides initial clues about evolutionary age and functional importance

  • Multiple sequence alignment analysis:

    • Align MJ0131 with identified homologs using tools optimized for distant relationships

    • Examine patterns of conserved residues across alignments

    • Distinguish between:

      • Universally conserved residues (likely functional or structural importance)

      • Clade-specific conservation (potential specialization)

      • Correlated mutations (possible functional coupling)

  • Positional conservation mapping to structure:

    • Map conservation scores onto the predicted or determined structure of MJ0131

    • Clusters of conserved surface residues often indicate binding sites or catalytic sites

    • Conserved hydrophobic core residues typically maintain structural integrity

  • Thermophilic adaptation signatures:

    • Compare MJ0131 sequences from thermophiles versus mesophiles (if homologs exist in both)

    • Identify amino acid substitution patterns associated with thermal adaptation

    • Differentiate between thermostability-related conservation and function-related conservation

  • Genomic context conservation:

    • Analyze whether MJ0131's genomic neighborhood is conserved across species

    • Conserved gene clusters often indicate functional relationships or participation in the same pathway

    • This contextual information can provide functional hints even when sequence conservation is limited

  • Interpreting conservation in the absence of characterization:

    • High conservation across diverse species suggests fundamental importance

    • Archaeal-specific conservation may indicate domain-specific processes

    • Conservation restricted to extremophiles may relate to environmental adaptation

    • Lack of conservation beyond close relatives might indicate recent evolutionary origin or rapid divergence

  • Correlation with structural features:

    • Analyze whether conserved regions correspond to predicted binding pockets or structural motifs

    • This correlation strengthens functional hypotheses derived from structure-based prediction methods

Conservation pattern analysis serves as a powerful tool for generating functional hypotheses about uncharacterized proteins like MJ0131, particularly when integrated with structural and biochemical data.

What statistical approaches are appropriate for analyzing structure-function relationships in uncharacterized proteins?

When analyzing structure-function relationships in uncharacterized proteins like MJ0131, several statistical approaches are appropriate:

  • Structural similarity metrics:

    • TM-score, RMSD, and GDT-TS for quantifying structural similarity to proteins of known function

    • Z-scores to assess the statistical significance of structural similarity

    • Quantitative comparison of binding site geometry using tools like ProBiS

    • These metrics help distinguish significant structural relationships from random similarities

  • Machine learning classification models:

    • Supervised learning approaches using features derived from structure

    • Feature importance analysis to identify structural characteristics most predictive of function

    • Cross-validation to assess prediction reliability

    • Ensemble methods to improve robustness of functional predictions

  • Network-based approaches:

    • Construction of protein structure similarity networks

    • Community detection to identify clusters of functionally related proteins

    • Centrality measures to identify functionally important structural features

    • These approaches are particularly useful for placing MJ0131 in the context of the protein structure universe

  • Bayesian statistical frameworks:

    • Integration of multiple sources of evidence (structural, genomic, phylogenetic)

    • Calculation of posterior probabilities for different functional hypotheses

    • Updating functional predictions as new data becomes available

    • This approach explicitly handles uncertainty in functional prediction

  • Molecular dynamics statistical analysis:

    • Principal component analysis of molecular dynamics trajectories

    • Clustering of conformational states

    • Statistical assessment of binding free energy calculations

    • Correlation analysis of residue movements

    • These analyses help characterize the conformational landscape and binding properties

  • Conservation statistics:

    • Shannon entropy and other information-theoretic measures of conservation

    • Statistical coupling analysis to identify co-evolving residues

    • Enrichment analysis of amino acid compositions in different structural regions

    • These approaches help identify functionally important residues

  • Statistical validation of docking results:

    • Scoring functions to rank ligand binding poses

    • Enrichment factors to assess docking performance

    • Statistical significance of binding energy differences

    • These methods help identify the most likely binding partners from virtual screening

  • Multiple hypothesis testing corrections:

    • Bonferroni, Benjamini-Hochberg, or other corrections when testing multiple functional hypotheses

    • Confidence intervals for binding affinity predictions

    • These approaches control false discovery rates in functional prediction

The specific methods most appropriate for MJ0131 will depend on the quality of structural data available and the specific hypotheses being tested about its function .

How can contradictory results in functional prediction be reconciled for proteins like MJ0131?

Reconciling contradictory results in functional prediction for uncharacterized proteins like MJ0131 requires a systematic approach:

By systematically addressing contradictions using these approaches, researchers can develop a coherent functional hypothesis for MJ0131 that best explains all available evidence, ultimately guiding experimental validation efforts.

What are the most promising directions for future research on MJ0131?

Based on the available information and analysis methods, several promising research directions emerge for MJ0131:

  • Comprehensive structural characterization: Determining the high-resolution structure of MJ0131 using X-ray crystallography or NMR spectroscopy would provide fundamental insights into its potential function . For this small protein (103 amino acids), NMR may be particularly suitable for capturing dynamic aspects of structure .

  • Structure-based binding site prediction: Following the successful approach used with Tm1631, computational analysis of the MJ0131 structure could identify potential binding sites and ligands, generating testable functional hypotheses . This approach is particularly valuable for proteins that lack clear sequence homology to characterized proteins.

  • Thermostability mechanism investigation: As a protein from a hyperthermophile, MJ0131 likely contains adaptations for function at high temperatures . Comparative analysis with mesophilic homologs (if identified) could reveal molecular mechanisms of thermoadaptation with potential biotechnological applications.

  • Protein-protein interaction network mapping: Identifying interaction partners of MJ0131 through techniques like pull-down assays or yeast two-hybrid screens would place it in a functional context within M. jannaschii's cellular processes . This could reveal its role even without direct functional characterization.

  • Targeted mutagenesis of conserved residues: Once conserved residues are identified through comparative sequence analysis, site-directed mutagenesis followed by functional assays could validate their importance and help elucidate function.

  • In vivo studies using archaeal expression systems: While technically challenging, expressing MJ0131 in archaeal hosts and studying phenotypic effects would provide insights into its native function under relevant physiological conditions .

  • Evolutionary analysis across extremophiles: Comparative genomic and structural analysis of MJ0131 homologs across diverse extremophiles could reveal patterns of adaptation and conservation that inform functional hypotheses .

These research directions, pursued in parallel, would maximize the likelihood of successfully characterizing this uncharacterized archaeal protein and potentially discovering novel biochemical functions or structural motifs adapted to extreme environments.

What are the broader implications of studying uncharacterized archaeal proteins?

Studying uncharacterized archaeal proteins like MJ0131 has several broader implications:

  • Evolutionary biology insights: Archaea represent a distinct domain of life, and characterizing their unique proteins provides crucial data for understanding early cellular evolution and the diversification of life . Uncharacterized proteins may represent archaeal-specific innovations that illuminate domain-specific adaptations and evolutionary trajectories.

  • Extremophile adaptation mechanisms: M. jannaschii proteins have evolved to function under extreme conditions (high temperature, high pressure, moderate salinity) . Understanding their molecular adaptations provides insights into the limits of life and the diverse strategies organisms employ to thrive in hostile environments.

  • Novel enzymatic activities discovery: Uncharacterized proteins from archaea frequently reveal novel enzymatic activities or mechanisms not found in bacteria or eukaryotes . Such discoveries expand our understanding of biochemical diversity and potentially provide new tools for biotechnology.

  • Improved functional annotation methods: Developing and validating methods to predict function for challenging cases like MJ0131 improves computational approaches for the thousands of other uncharacterized proteins in sequenced genomes . Structure-based function prediction methods that succeed with archaeal proteins can be applied more broadly.

  • Biotechnological applications: Thermostable proteins from hyperthermophiles have numerous applications in industrial processes and molecular biology techniques due to their exceptional stability . Characterized archaeal proteins may yield new thermostable enzymes for biotechnology.

  • Expansion of protein structure-function relationships: Each newly characterized archaeal protein contributes to our understanding of the relationships between protein sequence, structure, and function, potentially revealing novel structural motifs or functional mechanisms .

  • Early Earth biochemistry insights: As many archaea (particularly methanogens like M. jannaschii) employ ancient metabolic pathways, studying their proteins provides glimpses into early Earth biochemistry and the origins of core metabolic processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.