Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0165 (MJ0165)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0165 (MJ0165) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . The protein MJ0165 is currently annotated as an uncharacterized protein, indicating that its specific function within the organism is not yet确切地 understood .

Basic Information

CategoryDescription
Full NameRecombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0165(Mj0165) Protein, His-Tagged
SpeciesMethanocaldococcus jannaschii
SourceE. coli
TagHis
Protein LengthFull Length (1-256 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDQ57629
Molecular WeightPredicted to be around 29 kDa, based on the amino acid sequence.

Gene Information

Gene NameSynonyms
MJ0165MJ0165; Uncharacterized protein MJ0165

Amino Acid Sequence

The amino acid sequence of MJ0165 is :
MGKNLRDLLLAFKNGDISLDEIEKQIKLNYYEEIEERLKLDINRQFRTGVPEVVYGKGKDIDEIIKATLKLVEKNGIALATKIEDIEKLSDEIRKWNLKNYDIKINKKAKTLIIKNKNYEVKKIGKVGILTAGTSDIPVAEEAKDTLEIMGVEAITAYDVGIAGIHRLFPALKRMIEEDVCCIIVVAGMEGALPSVIASMVDIPVIGVPTSTSYGIKITPLLTMLHSCSPGIAVVNIDNGFGAGVFAGLIAKIMHK

Production and Availability

Recombinant MJ0165 protein is produced in E. coli and is available with an N-terminal His tag to facilitate purification using affinity chromatography .

Potential Functions

Although MJ0165 is currently annotated as an uncharacterized protein, several approaches can be used to predict its potential functions:

  • Sequence analysis: Identifying conserved domains or motifs within the MJ0165 sequence can provide insights into its biochemical activity .

  • Structural modeling: Predicting the 3D structure of MJ0165 can help identify potential binding sites or catalytic centers .

  • Interactome studies: Identifying proteins that interact with MJ0165 can provide clues about its role in cellular processes .

  • Metabolic reconstruction: Integrating MJ0165 into the metabolic network of M. jannaschii can help predict its function in specific pathways .

Experimental Studies

Experimental studies are essential to elucidate the function of MJ0165. Potential experiments include:

  • Biochemical assays: Testing MJ0165 for various enzymatic activities can help identify its catalytic function.

  • Protein-protein interaction studies: Identifying proteins that interact with MJ0165 can provide insights into its role in cellular processes.

  • Gene knockout studies: Deleting the MJ0165 gene from M. jannaschii and observing the resulting phenotype can reveal its physiological function.

Methanocaldococcus jannaschii Background

Methanocaldococcus jannaschii is a hyperthermophilic archaeon that belongs to the Euryarchaeota phylum . It was the first archaeal genome to be sequenced, providing valuable insights into the biology of archaea and the evolution of life . M. jannaschii is found in deep-sea hydrothermal vents, where it thrives in high-temperature and high-pressure conditions . It is a methanogen, meaning it produces methane as a primary metabolic product .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0165; Uncharacterized protein MJ0165
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0165
Target Protein Sequence
MGKNLRDLLLAFKNGDISLDEIEKQIKLNYYEEIEERLKLDINRQFRTGVPEVVYGKGKD IDEIIKATLKLVEKNGIALATKIEDIEKLSDEIRKWNLKNYDIKINKKAKTLIIKNKNYE VKKIGKVGILTAGTSDIPVAEEAKDTLEIMGVEAITAYDVGIAGIHRLFPALKRMIEEDV CCIIVVAGMEGALPSVIASMVDIPVIGVPTSTSYGIKITPLLTMLHSCSPGIAVVNIDNG FGAGVFAGLIAKIMHK
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0165

STRING: 243232.MJ_0165

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for recombinant MJ0165 production?

  • Vector selection: pET-based expression vectors under T7 promoter control are commonly employed for archaeal protein expression in E. coli

  • Host strain optimization: BL21(DE3) and its derivatives are preferred for thermophilic protein expression

  • Induction conditions: Lower induction temperatures (15-25°C) may improve solubility despite the protein's thermophilic origin

  • Codon optimization: Adaptation of the coding sequence to E. coli codon usage can significantly improve expression yields

For researchers seeking to express the protein in its native host, note that M. jannaschii can be genetically manipulated using heat shock transformation methods as described for other proteins in this organism .

How should MJ0165 protein be stored to maintain stability and activity?

The recombinant MJ0165 protein requires specific storage conditions to preserve stability and functionality. Based on established protocols, the following methodology is recommended:

  • Store the lyophilized powder at -20°C or -80°C upon receipt

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 30-50% for long-term storage at -20°C or -80°C

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles, which can significantly reduce protein stability

  • For working stocks, maintain aliquots at 4°C for no longer than one week

Research shows that repeated freeze-thaw cycles dramatically reduce the activity of thermostable proteins despite their apparent robustness at high temperatures. When planning experiments, prepare only the amount needed for immediate use.

What approaches can be used to determine the function of the uncharacterized MJ0165 protein?

Determining the function of uncharacterized proteins like MJ0165 requires a multi-faceted approach. Consider implementing the following methodological strategy:

  • Computational analysis:

    • Perform sequence homology searches against characterized proteins

    • Use protein structure prediction tools (AlphaFold2, RoseTTAFold) to generate structural models

    • Identify conserved domains and motifs that might suggest enzymatic function

  • Biochemical characterization:

    • Assess potential enzymatic activities based on sequence predictions

    • Screen against substrate libraries under varying conditions (temperature, pH, cofactors)

    • Perform enzyme kinetics studies if activity is detected

  • Structural biology:

    • Crystallize the protein for X-ray crystallography

    • Employ NMR spectroscopy for solution structure determination

    • Use cryo-EM for structural analysis if the protein forms larger complexes

  • Genetic approaches:

    • Generate knockout strains in M. jannaschii using the established genetic system

    • Perform complementation studies with wild-type and mutant variants

    • Analyze phenotypic changes under various growth conditions

When publishing functional characterization results, ensure comprehensive reporting of both positive and negative findings to guide future research efforts.

How can I engineer M. jannaschii to express tagged MJ0165 for in vivo studies?

To express tagged MJ0165 in M. jannaschii, researchers can adapt the genetic system developed for this organism. The methodology involves:

  • Construct a suicide plasmid similar to pDS261 used for Mj-FprA expression :

    • Include elements representing upstream and 5'-end coding regions of MJ0165

    • Design for double cross-over homologous recombination between linearized plasmid and chromosome

    • Incorporate an affinity tag sequence (e.g., 3xFLAG-twin Strep tag) at the N- or C-terminus

    • Place the modified gene under a strong promoter such as P* or PflaB1B2

  • Transform M. jannaschii using heat shock method:

    • Grow cells at 65°C to make them more permissive to DNA uptake due to membrane lipid composition changes

    • Mix cells with linearized plasmid DNA

    • Apply heat shock transformation without CaCl₂ treatment

    • Plate on selective medium containing appropriate antibiotic (e.g., mevinolin at 10 μM)

  • Verify recombination:

    • Screen transformants using PCR to confirm integration

    • Sequence the modified locus to ensure correct in-frame fusion

    • Verify protein expression by Western blot using antibodies against the affinity tag

The efficiency of this process typically yields approximately 10⁴ transformants per microgram of plasmid DNA, though variations may occur depending on strain and specific genomic locus .

What structural features enable MJ0165 to function in extreme conditions?

Understanding the structural adaptations of MJ0165 to extreme conditions requires detailed structural analysis. Approach this question methodologically by:

  • Analyzing thermostability determinants:

    • Higher proportion of charged amino acids forming ion pairs

    • Increased hydrophobic core packing

    • Reduced number of thermolabile residues

    • Enhanced disulfide bridge formation

  • Examining sequence features:

    • The primary sequence of MJ0165 contains several regions that suggest structural stabilization through hydrophobic clustering and potential ion pair networks

    • Specific motifs in the sequence (e.g., GIAGIHRLFPAL) may contribute to thermostability

  • Conducting comparative thermal stability assays:

    • Differential scanning calorimetry (DSC) measurements

    • Circular dichroism (CD) spectroscopy at increasing temperatures

    • Thermal shift assays with varying buffer conditions

  • Performing molecular dynamics simulations:

    • Model protein behavior at different temperatures (25°C vs. 85°C)

    • Analyze conformational flexibility and rigidity at elevated temperatures

    • Identify critical stabilizing interactions that persist under extreme conditions

These approaches will yield insights into the molecular basis of extremophile protein stability that can inform protein engineering efforts for industrial applications.

What are the optimal purification methods for recombinant MJ0165?

For efficient purification of His-tagged recombinant MJ0165, implement this methodological workflow:

  • Cell lysis optimization:

    • For E. coli-expressed protein: sonication or pressure-based lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors

    • Consider heat treatment (70°C for 20 minutes) as a first purification step, exploiting the thermostability of MJ0165 to denature most E. coli proteins

  • Immobilized metal affinity chromatography (IMAC):

    • Use Ni-NTA or TALON resins with step-wise elution using increasing imidazole concentrations

    • Optimize binding conditions with attention to pH, salt concentration, and reducing agents

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and achieve >95% purity

    • Ion exchange chromatography as an alternative or additional step

  • Quality control assessment:

    • SDS-PAGE to verify purity (>90% is typically achievable)

    • Western blot with anti-His antibodies to confirm identity

    • Mass spectrometry to verify protein integrity and modifications

For native purification from M. jannaschii, adaptation of methods used for other tagged proteins such as Mj-FprA can be employed, which yielded 0.26 mg purified protein per liter of culture .

How do I design optimal experiments to characterize potential enzymatic activities of MJ0165?

When investigating potential enzymatic activities of MJ0165, follow this structured experimental approach:

  • Initial activity screening:

    • Conduct parallel assays targeting different enzyme classes (hydrolases, transferases, oxidoreductases, etc.)

    • Test at different temperatures (25°C, 65°C, and 85°C) reflecting mesophilic conditions and M. jannaschii's growth optima

    • Use a multiwell format with colorimetric or fluorometric readouts for high-throughput screening

  • Optimization of reaction conditions:

    • Temperature range: 60-90°C (M. jannaschii grows optimally at 85°C with a generation time of 26 minutes)

    • pH range: 5.5-8.0

    • Salt concentration: 0.1-0.5 M

    • Potential cofactors: ATP, metal ions, coenzymes

  • Kinetic parameter determination:

    • For initial characterization, use substrate concentrations ranging from 0.1-10× estimated Km

    • Determine Vmax, Km, kcat, and kcat/Km under optimal conditions

    • Compare parameters at different temperatures to assess thermodynamic activation parameters

  • Specificity profiling:

    • Test structurally related substrates to establish specificity patterns

    • Examine inhibition profiles with standard inhibitors for the enzyme class

Document all negative results alongside positive findings to comprehensively map the functional landscape of MJ0165.

What are the considerations for expressing MJ0165 in its active form?

Ensuring proper folding and activity of recombinant MJ0165 requires attention to several factors:

  • Expression temperature considerations:

    • Despite M. jannaschii's optimal growth at 85°C, expression in E. coli should be conducted at lower temperatures (15-25°C) to balance protein production with proper folding

    • Induction at higher cell densities (OD600 ~0.8) often improves soluble protein yield

  • Buffer optimization:

    • Include stabilizing agents (glycerol, trehalose) in purification buffers

    • Test the effect of kosmotropic salts (ammonium sulfate, potassium phosphate) on stability

    • For long-term storage, Tris/PBS-based buffer with 6% trehalose at pH 8.0 is recommended

  • Refolding strategies if needed:

    • On-column refolding during IMAC purification

    • Dilution method with gradual removal of denaturants

    • Chaperone co-expression (GroEL/ES, DnaK systems) to assist folding

  • Activity verification:

    • Develop activity assays based on bioinformatic predictions

    • Compare activity of protein expressed under different conditions

    • Monitor thermal stability using differential scanning fluorimetry

Understanding the natural environment of M. jannaschii (high temperature, high pressure) can guide the development of conditions that maintain native protein structure and function.

How can I resolve common issues in M. jannaschii transformation when expressing MJ0165?

When experiencing difficulties with M. jannaschii transformation for MJ0165 expression, implement this systematic troubleshooting approach:

  • Transformation efficiency issues:

    • Confirm growth at 65°C rather than 85°C before transformation to make cells more permissive to DNA uptake due to membrane lipid composition changes

    • Ensure cells are in exponential growth phase (generation time at 65°C is approximately 111 minutes)

    • Use linearized plasmid DNA to promote double crossover events rather than circular vectors

    • Optimize DNA concentration (1 μg typically yields ~10⁴ transformants)

  • Selective marker considerations:

    • Verify mevinolin concentration (10 μM is standard) for selection plates

    • Prepare fresh selective media as some antibiotics degrade at high temperatures

    • Include proper controls (transformation without DNA should yield no colonies)

  • Recombination verification:

    • Use PCR with primers flanking the integration site

    • Perform whole-genome sequencing if unexpected phenotypes emerge

    • Consider that laboratory strains may differ in transformation efficiency from repository strains

  • Culture handling:

    • Maintain strict anaerobic conditions throughout the process

    • Use pre-reduced media and minimize exposure to oxygen

    • Process cells quickly to prevent stress responses

For optimal results, note that M. jannaschii DSM 2661 (type strain from culture collections) shows approximately half the transformation efficiency compared to laboratory-adapted strains .

What analytical methods should I use to assess MJ0165 structure-function relationships?

To establish structure-function relationships for MJ0165, employ these analytical approaches:

  • Site-directed mutagenesis strategy:

    • Identify conserved residues through multiple sequence alignments

    • Target residues clustered in potential active sites

    • Create alanine scanning libraries covering suspected functional regions

    • Engineer single, double, and compensatory mutations to test mechanistic hypotheses

  • Structural analysis methodology:

    • X-ray crystallography at resolutions <2.0 Å to visualize atomic details

    • NMR for dynamic regions and ligand binding studies

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational changes

    • Small-angle X-ray scattering (SAXS) for solution structure determination

  • Functional assays for mutant variants:

    • Develop high-throughput activity screens

    • Measure thermostability changes using thermal shift assays

    • Assess kinetic parameters to quantify effects on catalysis

    • Perform ligand binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)

  • Computational analysis integration:

    • Molecular dynamics simulations to explore conformational landscape

    • Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism modeling

    • Machine learning approaches to identify patterns in structure-function data

This integrated approach provides multiple lines of evidence to establish mechanistic understanding of MJ0165 function.

How can I distinguish between the activities of MJ0165 and potential contaminating proteins?

Ensuring that observed enzymatic activities are attributable to MJ0165 rather than contaminants requires rigorous controls and validation:

  • Purification validation strategy:

    • Achieve >95% purity as confirmed by SDS-PAGE and silver staining

    • Verify protein identity through mass spectrometry peptide mapping

    • Perform Western blot analysis with tag-specific antibodies

    • Include size exclusion chromatography as a final purification step

  • Negative control experiments:

    • Test buffer-only controls in all assays

    • Prepare mock purifications from expression hosts without MJ0165

    • Use heat-denatured MJ0165 samples as negative controls

  • Activity correlation experiments:

    • Compare activity across multiple purification batches

    • Analyze correlation between protein concentration and activity

    • Perform activity assays on different fractions from purification steps

  • Validation through multiple approaches:

    • Confirm activity using different detection methods

    • Demonstrate inhibition by specific antibodies against MJ0165

    • Show that site-directed mutants have altered activity profiles consistent with mechanistic hypotheses

These methodological controls help establish that the observed activities are intrinsic to MJ0165 rather than artifacts or contaminants.

What are promising applications of MJ0165 in biotechnology and synthetic biology?

The thermostable nature of MJ0165 from the hyperthermophile M. jannaschii presents several potential applications in biotechnology:

  • Enzyme technology development:

    • Once characterized, MJ0165 could be engineered for specific industrial processes requiring high-temperature stability

    • Potential applications in biocatalysis for pharmaceuticals, fine chemicals, or biofuels

    • Template for protein engineering studies to understand and enhance thermostability

  • Synthetic biology platforms:

    • Component in thermophilic synthetic biology systems

    • Potential orthogonal functions in mesophilic hosts

    • Model for designing synthetic thermostable proteins with novel functions

  • Structural biology contributions:

    • Understanding fundamental principles of protein thermostability

    • Development of stabilization strategies for mesophilic proteins

    • Insights into protein evolution under extreme conditions

  • Expression system advancements:

    • The genetic tools developed for M. jannaschii could be leveraged to create thermophilic expression platforms

    • High-temperature bioprocessing to reduce contamination risks

    • Integration with continuous flow systems for industrial applications

For each application, systematic protein engineering and characterization will be necessary to optimize performance and specificity.

How might comparative studies between MJ0165 and its mesophilic homologs inform protein engineering?

Comparative analysis between MJ0165 and mesophilic homologs can provide valuable insights for protein engineering:

  • Evolutionary adaptation analysis:

    • Identify conserved vs. variable regions across temperature adaptations

    • Determine positively selected sites associated with thermostability

    • Reconstruct ancestral sequences to understand evolutionary trajectories

  • Structural comparisons methodology:

    • Superimpose crystal structures or models to identify thermostability-associated structural features

    • Analyze differences in surface charge distribution, hydrophobic core packing, and loop regions

    • Quantify differences in conformational flexibility using molecular dynamics simulations

  • Hybrid protein design strategy:

    • Create chimeric proteins with domains from thermophilic and mesophilic homologs

    • Perform domain swapping experiments to isolate stability-determining regions

    • Introduce stabilizing features from MJ0165 into mesophilic counterparts

  • Practical application framework:

    • Develop a design algorithm based on identified principles

    • Test stabilization strategies on industrially relevant enzymes

    • Establish quantitative structure-stability relationships

This comparative approach provides both fundamental insights into protein stability mechanisms and practical strategies for engineering enhanced proteins for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.