Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0165 (MJ0165) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . The protein MJ0165 is currently annotated as an uncharacterized protein, indicating that its specific function within the organism is not yet确切地 understood .
| Category | Description |
|---|---|
| Full Name | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0165(Mj0165) Protein, His-Tagged |
| Species | Methanocaldococcus jannaschii |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-256 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| UniProt ID | Q57629 |
| Molecular Weight | Predicted to be around 29 kDa, based on the amino acid sequence. |
| Gene Name | Synonyms |
|---|---|
| MJ0165 | MJ0165; Uncharacterized protein MJ0165 |
The amino acid sequence of MJ0165 is :
MGKNLRDLLLAFKNGDISLDEIEKQIKLNYYEEIEERLKLDINRQFRTGVPEVVYGKGKDIDEIIKATLKLVEKNGIALATKIEDIEKLSDEIRKWNLKNYDIKINKKAKTLIIKNKNYEVKKIGKVGILTAGTSDIPVAEEAKDTLEIMGVEAITAYDVGIAGIHRLFPALKRMIEEDVCCIIVVAGMEGALPSVIASMVDIPVIGVPTSTSYGIKITPLLTMLHSCSPGIAVVNIDNGFGAGVFAGLIAKIMHK
Recombinant MJ0165 protein is produced in E. coli and is available with an N-terminal His tag to facilitate purification using affinity chromatography .
Although MJ0165 is currently annotated as an uncharacterized protein, several approaches can be used to predict its potential functions:
Sequence analysis: Identifying conserved domains or motifs within the MJ0165 sequence can provide insights into its biochemical activity .
Structural modeling: Predicting the 3D structure of MJ0165 can help identify potential binding sites or catalytic centers .
Interactome studies: Identifying proteins that interact with MJ0165 can provide clues about its role in cellular processes .
Metabolic reconstruction: Integrating MJ0165 into the metabolic network of M. jannaschii can help predict its function in specific pathways .
Experimental studies are essential to elucidate the function of MJ0165. Potential experiments include:
Biochemical assays: Testing MJ0165 for various enzymatic activities can help identify its catalytic function.
Protein-protein interaction studies: Identifying proteins that interact with MJ0165 can provide insights into its role in cellular processes.
Gene knockout studies: Deleting the MJ0165 gene from M. jannaschii and observing the resulting phenotype can reveal its physiological function.
Methanocaldococcus jannaschii is a hyperthermophilic archaeon that belongs to the Euryarchaeota phylum . It was the first archaeal genome to be sequenced, providing valuable insights into the biology of archaea and the evolution of life . M. jannaschii is found in deep-sea hydrothermal vents, where it thrives in high-temperature and high-pressure conditions . It is a methanogen, meaning it produces methane as a primary metabolic product .
KEGG: mja:MJ_0165
STRING: 243232.MJ_0165
Vector selection: pET-based expression vectors under T7 promoter control are commonly employed for archaeal protein expression in E. coli
Host strain optimization: BL21(DE3) and its derivatives are preferred for thermophilic protein expression
Induction conditions: Lower induction temperatures (15-25°C) may improve solubility despite the protein's thermophilic origin
Codon optimization: Adaptation of the coding sequence to E. coli codon usage can significantly improve expression yields
For researchers seeking to express the protein in its native host, note that M. jannaschii can be genetically manipulated using heat shock transformation methods as described for other proteins in this organism .
The recombinant MJ0165 protein requires specific storage conditions to preserve stability and functionality. Based on established protocols, the following methodology is recommended:
Store the lyophilized powder at -20°C or -80°C upon receipt
For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 30-50% for long-term storage at -20°C or -80°C
Aliquot the protein solution to avoid repeated freeze-thaw cycles, which can significantly reduce protein stability
For working stocks, maintain aliquots at 4°C for no longer than one week
Research shows that repeated freeze-thaw cycles dramatically reduce the activity of thermostable proteins despite their apparent robustness at high temperatures. When planning experiments, prepare only the amount needed for immediate use.
Determining the function of uncharacterized proteins like MJ0165 requires a multi-faceted approach. Consider implementing the following methodological strategy:
Computational analysis:
Perform sequence homology searches against characterized proteins
Use protein structure prediction tools (AlphaFold2, RoseTTAFold) to generate structural models
Identify conserved domains and motifs that might suggest enzymatic function
Biochemical characterization:
Assess potential enzymatic activities based on sequence predictions
Screen against substrate libraries under varying conditions (temperature, pH, cofactors)
Perform enzyme kinetics studies if activity is detected
Structural biology:
Crystallize the protein for X-ray crystallography
Employ NMR spectroscopy for solution structure determination
Use cryo-EM for structural analysis if the protein forms larger complexes
Genetic approaches:
When publishing functional characterization results, ensure comprehensive reporting of both positive and negative findings to guide future research efforts.
To express tagged MJ0165 in M. jannaschii, researchers can adapt the genetic system developed for this organism. The methodology involves:
Construct a suicide plasmid similar to pDS261 used for Mj-FprA expression :
Include elements representing upstream and 5'-end coding regions of MJ0165
Design for double cross-over homologous recombination between linearized plasmid and chromosome
Incorporate an affinity tag sequence (e.g., 3xFLAG-twin Strep tag) at the N- or C-terminus
Place the modified gene under a strong promoter such as P* or PflaB1B2
Transform M. jannaschii using heat shock method:
Verify recombination:
Screen transformants using PCR to confirm integration
Sequence the modified locus to ensure correct in-frame fusion
Verify protein expression by Western blot using antibodies against the affinity tag
The efficiency of this process typically yields approximately 10⁴ transformants per microgram of plasmid DNA, though variations may occur depending on strain and specific genomic locus .
Understanding the structural adaptations of MJ0165 to extreme conditions requires detailed structural analysis. Approach this question methodologically by:
Analyzing thermostability determinants:
Higher proportion of charged amino acids forming ion pairs
Increased hydrophobic core packing
Reduced number of thermolabile residues
Enhanced disulfide bridge formation
Examining sequence features:
Conducting comparative thermal stability assays:
Differential scanning calorimetry (DSC) measurements
Circular dichroism (CD) spectroscopy at increasing temperatures
Thermal shift assays with varying buffer conditions
Performing molecular dynamics simulations:
Model protein behavior at different temperatures (25°C vs. 85°C)
Analyze conformational flexibility and rigidity at elevated temperatures
Identify critical stabilizing interactions that persist under extreme conditions
These approaches will yield insights into the molecular basis of extremophile protein stability that can inform protein engineering efforts for industrial applications.
For efficient purification of His-tagged recombinant MJ0165, implement this methodological workflow:
Cell lysis optimization:
For E. coli-expressed protein: sonication or pressure-based lysis in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, and protease inhibitors
Consider heat treatment (70°C for 20 minutes) as a first purification step, exploiting the thermostability of MJ0165 to denature most E. coli proteins
Immobilized metal affinity chromatography (IMAC):
Use Ni-NTA or TALON resins with step-wise elution using increasing imidazole concentrations
Optimize binding conditions with attention to pH, salt concentration, and reducing agents
Secondary purification:
Size exclusion chromatography to remove aggregates and achieve >95% purity
Ion exchange chromatography as an alternative or additional step
Quality control assessment:
For native purification from M. jannaschii, adaptation of methods used for other tagged proteins such as Mj-FprA can be employed, which yielded 0.26 mg purified protein per liter of culture .
When investigating potential enzymatic activities of MJ0165, follow this structured experimental approach:
Initial activity screening:
Conduct parallel assays targeting different enzyme classes (hydrolases, transferases, oxidoreductases, etc.)
Test at different temperatures (25°C, 65°C, and 85°C) reflecting mesophilic conditions and M. jannaschii's growth optima
Use a multiwell format with colorimetric or fluorometric readouts for high-throughput screening
Optimization of reaction conditions:
Kinetic parameter determination:
For initial characterization, use substrate concentrations ranging from 0.1-10× estimated Km
Determine Vmax, Km, kcat, and kcat/Km under optimal conditions
Compare parameters at different temperatures to assess thermodynamic activation parameters
Specificity profiling:
Test structurally related substrates to establish specificity patterns
Examine inhibition profiles with standard inhibitors for the enzyme class
Document all negative results alongside positive findings to comprehensively map the functional landscape of MJ0165.
Ensuring proper folding and activity of recombinant MJ0165 requires attention to several factors:
Expression temperature considerations:
Despite M. jannaschii's optimal growth at 85°C, expression in E. coli should be conducted at lower temperatures (15-25°C) to balance protein production with proper folding
Induction at higher cell densities (OD600 ~0.8) often improves soluble protein yield
Buffer optimization:
Refolding strategies if needed:
On-column refolding during IMAC purification
Dilution method with gradual removal of denaturants
Chaperone co-expression (GroEL/ES, DnaK systems) to assist folding
Activity verification:
Develop activity assays based on bioinformatic predictions
Compare activity of protein expressed under different conditions
Monitor thermal stability using differential scanning fluorimetry
Understanding the natural environment of M. jannaschii (high temperature, high pressure) can guide the development of conditions that maintain native protein structure and function.
When experiencing difficulties with M. jannaschii transformation for MJ0165 expression, implement this systematic troubleshooting approach:
Transformation efficiency issues:
Confirm growth at 65°C rather than 85°C before transformation to make cells more permissive to DNA uptake due to membrane lipid composition changes
Ensure cells are in exponential growth phase (generation time at 65°C is approximately 111 minutes)
Use linearized plasmid DNA to promote double crossover events rather than circular vectors
Optimize DNA concentration (1 μg typically yields ~10⁴ transformants)
Selective marker considerations:
Recombination verification:
Culture handling:
Maintain strict anaerobic conditions throughout the process
Use pre-reduced media and minimize exposure to oxygen
Process cells quickly to prevent stress responses
For optimal results, note that M. jannaschii DSM 2661 (type strain from culture collections) shows approximately half the transformation efficiency compared to laboratory-adapted strains .
To establish structure-function relationships for MJ0165, employ these analytical approaches:
Site-directed mutagenesis strategy:
Identify conserved residues through multiple sequence alignments
Target residues clustered in potential active sites
Create alanine scanning libraries covering suspected functional regions
Engineer single, double, and compensatory mutations to test mechanistic hypotheses
Structural analysis methodology:
X-ray crystallography at resolutions <2.0 Å to visualize atomic details
NMR for dynamic regions and ligand binding studies
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe conformational changes
Small-angle X-ray scattering (SAXS) for solution structure determination
Functional assays for mutant variants:
Develop high-throughput activity screens
Measure thermostability changes using thermal shift assays
Assess kinetic parameters to quantify effects on catalysis
Perform ligand binding studies using isothermal titration calorimetry (ITC) or microscale thermophoresis (MST)
Computational analysis integration:
Molecular dynamics simulations to explore conformational landscape
Quantum mechanics/molecular mechanics (QM/MM) for reaction mechanism modeling
Machine learning approaches to identify patterns in structure-function data
This integrated approach provides multiple lines of evidence to establish mechanistic understanding of MJ0165 function.
Ensuring that observed enzymatic activities are attributable to MJ0165 rather than contaminants requires rigorous controls and validation:
Purification validation strategy:
Negative control experiments:
Test buffer-only controls in all assays
Prepare mock purifications from expression hosts without MJ0165
Use heat-denatured MJ0165 samples as negative controls
Activity correlation experiments:
Compare activity across multiple purification batches
Analyze correlation between protein concentration and activity
Perform activity assays on different fractions from purification steps
Validation through multiple approaches:
Confirm activity using different detection methods
Demonstrate inhibition by specific antibodies against MJ0165
Show that site-directed mutants have altered activity profiles consistent with mechanistic hypotheses
These methodological controls help establish that the observed activities are intrinsic to MJ0165 rather than artifacts or contaminants.
The thermostable nature of MJ0165 from the hyperthermophile M. jannaschii presents several potential applications in biotechnology:
Enzyme technology development:
Once characterized, MJ0165 could be engineered for specific industrial processes requiring high-temperature stability
Potential applications in biocatalysis for pharmaceuticals, fine chemicals, or biofuels
Template for protein engineering studies to understand and enhance thermostability
Synthetic biology platforms:
Component in thermophilic synthetic biology systems
Potential orthogonal functions in mesophilic hosts
Model for designing synthetic thermostable proteins with novel functions
Structural biology contributions:
Understanding fundamental principles of protein thermostability
Development of stabilization strategies for mesophilic proteins
Insights into protein evolution under extreme conditions
Expression system advancements:
For each application, systematic protein engineering and characterization will be necessary to optimize performance and specificity.
Comparative analysis between MJ0165 and mesophilic homologs can provide valuable insights for protein engineering:
Evolutionary adaptation analysis:
Identify conserved vs. variable regions across temperature adaptations
Determine positively selected sites associated with thermostability
Reconstruct ancestral sequences to understand evolutionary trajectories
Structural comparisons methodology:
Superimpose crystal structures or models to identify thermostability-associated structural features
Analyze differences in surface charge distribution, hydrophobic core packing, and loop regions
Quantify differences in conformational flexibility using molecular dynamics simulations
Hybrid protein design strategy:
Create chimeric proteins with domains from thermophilic and mesophilic homologs
Perform domain swapping experiments to isolate stability-determining regions
Introduce stabilizing features from MJ0165 into mesophilic counterparts
Practical application framework:
Develop a design algorithm based on identified principles
Test stabilization strategies on industrially relevant enzymes
Establish quantitative structure-stability relationships
This comparative approach provides both fundamental insights into protein stability mechanisms and practical strategies for engineering enhanced proteins for biotechnological applications.