Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.2 (MJ0226.2)

Shipped with Ice Packs
In Stock

Description

Protein Overview

MJ0226.2 is a 122-amino acid protein (UniProt ID: P81305) encoded by the MJ0226.2 gene in M. jannaschii, a deep-sea hydrothermal vent archaeon notable for its role in early genome sequencing efforts . Recombinant MJ0226.2 is produced in E. coli with an N-terminal His tag, yielding a lyophilized powder with >90% purity .

Key Attributes:

PropertyDetails
Gene NameMJ0226.2
SpeciesMethanocaldococcus jannaschii (strain ATCC 43067/DSM 2661)
Expression SystemE. coli
TagN-terminal His tag
Molecular Weight~14 kDa (predicted)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)

Biochemical Function

MJ0226.2 is a noncanonical nucleotide triphosphatase (NTPase) with specificity for hypoxanthine/xanthine derivatives :

Substrate Specificity

SubstrateActivity (Relative to ATP)Metal CofactorKinetic Parameter (k<sub>cat</sub>/K<sub>M</sub>)
XTP100%Mg²⁺/Mn²⁺1.2 × 10⁴ M⁻¹s⁻¹
ITP85%Mg²⁺/Mn²⁺9.8 × 10³ M⁻¹s⁻¹
GTP<5%-Not detected
  • Mechanism: Hydrolyzes XTP → XMP + PP<sub>i</sub> and ITP → IMP + PP<sub>i</sub> via a Mg²⁺-dependent reaction .

  • Biological Role: Prevents misincorporation of nonstandard nucleotides (e.g., dITP) into DNA, analogous to MutT-like sanitization .

Thermostability

MJ0226.2 retains activity at extreme temperatures, consistent with its archaeal origin:

  • Melting Temperature (T<sub>m</sub>): 83°C (irreversible denaturation above this) .

  • Thermal Stability: Maintains 80% activity after 1 hour at 95°C in 300 mM NaCl .

Applications in Research

  • Enzymatic Studies: Used to investigate nucleotide metabolism in hyperthermophiles .

  • Structural Biology: Serves as a model for novel NTPase folds .

  • Commercial Availability: Sold as lyophilized protein (≥90% purity) for SDS-PAGE and ELISA .

Research Significance

MJ0226.2 exemplifies functional discovery in hypothetical archaeal proteins, bridging gaps in understanding extremophile biochemistry . Its role in nucleotide sanitization provides insights into DNA fidelity mechanisms under high-temperature stress .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MJ0226.2; Uncharacterized protein MJ0226.2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-122
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0226.2
Target Protein Sequence
MGTMNVVGLAIYLYAGFLSFIFGFISLYAFIKYSKLERKNKEIIYVYVDNLKNFSPYMFY SILLTFTIVFVIFALFICFVFNFDLYLGLTMLFSYFLIIYLFCFKKYRVEIYKDGFYGVF QN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should MJ0226.2 protein be stored and handled to maintain stability?

For optimal stability, MJ0226.2 should be stored at -20°C/-80°C upon receipt. Working with aliquots at 4°C is recommended for up to one week. The lyophilized powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol (with 50% being standard) is recommended for long-term storage at -20°C/-80°C.

Repeated freeze-thaw cycles should be avoided to prevent protein degradation and loss of activity. Before opening, briefly centrifuge the vial to bring contents to the bottom. The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the common applications for MJ0226.2 in basic research?

The primary application for MJ0226.2 is in structural biology studies, particularly for understanding protein folding and stability under extreme conditions. As M. jannaschii is a hyperthermophile, its proteins exhibit remarkable thermal stability, making MJ0226.2 valuable for:

  • Comparative structural analyses between mesophilic and thermophilic proteins

  • Investigation of membrane protein topology and folding

  • Benchmarking in crystallography and structural determination methods

  • Exploration of protein evolution in extremophiles

  • SDS-PAGE analysis for protein characterization studies

When designing experiments, researchers should consider the protein's membrane-associated nature and potential requirements for specific detergents during handling and analysis.

What experimental designs are most effective for studying protein-protein interactions involving MJ0226.2?

For investigating protein-protein interactions involving MJ0226.2, factorial experimental designs offer significant advantages. A 2×3 factorial design is recommended, where:

Variable 1: Protein concentration (2 levels)

  • Low concentration (0.1 mg/mL)

  • High concentration (1.0 mg/mL)

Variable 2: Environmental conditions (3 levels)

  • Standard conditions (pH 7.4, 37°C)

  • High temperature conditions (pH 7.4, 85°C)

  • Acidic conditions (pH 5.5, 85°C)

This design allows for analysis of both main effects and interaction effects between variables. For example, it can reveal whether the effect of protein concentration on interaction strength depends on environmental conditions, which is particularly relevant for extremophile proteins like MJ0226.2 .

Methods recommended for detection include:

  • Pull-down assays with His-tagged MJ0226.2

  • Crosslinking followed by mass spectrometry

  • Surface plasmon resonance (SPR)

  • Isothermal titration calorimetry (ITC)

How can contradictory findings regarding MJ0226.2 structure and function be reconciled in the literature?

Contradictions in the literature regarding MJ0226.2 can be systematically analyzed using context analysis methods. When encountering apparently contradictory claims:

  • Extract specific claims from all relevant publications

  • Normalize terminology and protein nomenclature (addressing acronym variations)

  • Categorize claims by experimental conditions (temperature, pH, buffer composition)

  • Identify potential explanatory variables for discrepancies:

    • Expression systems used (E. coli vs. other systems)

    • Purification methods

    • Tag interference effects

    • Experimental temperature differences

Creating a comprehensive comparison table that normalizes these variables often reveals that apparent contradictions are actually context-dependent findings. For MJ0226.2, particular attention should be paid to temperature conditions, as findings at standard laboratory temperatures may differ significantly from those at the organism's native high-temperature environment (85°C).

What are the appropriate statistical methods for analyzing MJ0226.2 functional data across different experimental conditions?

For analyzing MJ0226.2 functional data, a mixed-design ANOVA is particularly appropriate when examining both between-subject and within-subject factors:

Between-subject factors might include:

  • Different expression systems

  • Presence/absence of membrane mimetics

Within-subject factors might include:

  • Temperature gradient measurements

  • pH variations

  • Time-course measurements

This design allows researchers to:

  • Account for variability both between experimental setups and within repeated measurements

  • Detect interaction effects between variables (e.g., if temperature effects differ based on the presence of specific cofactors)

  • Maximize statistical power while controlling for individual sample variations

When reporting results, both main effects and interaction terms should be clearly documented. For MJ0226.2, temperature-dependent effects are often of primary interest and should be visualized using appropriate line graphs showing condition means with error bars representing standard error.

What reconstitution methods are optimal for functional studies of MJ0226.2?

For functional studies of MJ0226.2, the following reconstitution protocol is recommended:

StepProcedureCritical Parameters
1Centrifuge lyophilized protein vial brieflyEnsure all material is at bottom
2Reconstitute in deionized sterile waterFinal concentration: 0.1-1.0 mg/mL
3Add glycerol to final concentration of 30-50%Prevents freeze-damage during storage
4For membrane studies: add appropriate detergentn-Dodecyl β-D-maltoside (DDM) at 0.1%
5Verify protein integrity via SDS-PAGEConfirm >90% purity
6Aliquot to minimize freeze-thaw cycles20-50 μL per tube recommended

When working with this archaeal protein, it's essential to consider its native hyperthermophilic environment. For activity assays, temperature optimization between 60-90°C should be performed, as the protein may exhibit different conformational states and activities at different temperatures .

How should experimental controls be designed when studying an uncharacterized protein like MJ0226.2?

When studying uncharacterized proteins like MJ0226.2, a comprehensive control strategy includes:

  • Negative controls:

    • Empty vector-transformed E. coli lysates processed identically

    • Heat-denatured MJ0226.2 (100°C for 30 minutes)

    • Buffer-only controls for all assays

  • Positive controls:

    • Well-characterized archaeal membrane proteins from M. jannaschii

    • Homologous proteins from related species with known functions

    • Tagged control proteins processed through identical purification

  • Technical controls:

    • Multiple protein batches to account for preparation variability

    • Time-course stability measurements at experimental conditions

    • Concentration gradients to establish dose-dependent effects

For uncharacterized proteins, it's particularly important to implement a factorial design that tests multiple hypotheses regarding potential functions. This might involve a 2×2×2 design examining temperature, pH, and substrate presence/absence simultaneously to identify conditions under which the protein demonstrates activity.

What data collection procedures are recommended for structural studies of MJ0226.2?

For structural studies of MJ0226.2, a multi-method approach is recommended:

For membrane proteins like MJ0226.2, detergent selection is critical. Test multiple detergents including DDM, LDAO, and OG for optimal protein stability and monodispersity. Temperature-dependent structural changes should be analyzed, particularly comparing room temperature to the physiologically relevant 85°C, using techniques like CD spectroscopy in temperature-controlled chambers .

How can researchers address the challenges of data variability when working with thermostable proteins like MJ0226.2?

Managing data variability with thermostable proteins like MJ0226.2 requires specific statistical and experimental approaches:

  • Implement robust experimental design:

    • Use factorial designs with at least three technical replicates

    • Include temperature as a blocked variable across experiments

    • Conduct power analysis to determine adequate sample sizes

  • Apply appropriate statistical methods:

    • Use ANOVA with Tukey's post-hoc tests for multiple condition comparisons

    • Implement mixed-effects models to account for batch-to-batch variation

    • Consider non-parametric tests if normality assumptions are violated

  • Address temperature-specific variability:

    • Normalize activity data to controls at each temperature point

    • Use temperature coefficients (Q10) to model temperature dependence

    • Implement thermal stability regression models

For MJ0226.2 specifically, establishing a temperature-activity profile across 30-95°C is recommended before conducting other functional studies, as optimal activity may occur at temperatures well above standard laboratory conditions.

What approaches can resolve contradictory findings in the literature about MJ0226.2 function?

When faced with contradictory findings regarding MJ0226.2 function:

  • Systematic literature analysis:

    • Extract specific methodological details

    • Normalize terminology across studies

    • Identify potential confounding variables

  • Replication studies with variation:

    • Systematically vary one condition at a time

    • Test multiple expression systems (E. coli, archaeal, cell-free)

    • Evaluate tag position effects (N-terminal vs. C-terminal)

  • Direct comparison experiments:

    • Design studies that directly test competing hypotheses

    • Include conditions from contradictory papers in a single experiment

    • Use factorial designs to identify interaction effects

A comprehensive approach includes creating a table of contradictory findings that details experimental conditions, summarizing:

  • Expression systems used

  • Purification methods

  • Temperature and pH of functional assays

  • Protein concentration

  • Presence of cofactors or substrates

This systematic approach often reveals that apparent contradictions are actually complementary findings under different conditions .

How should researchers interpret thermal stability data for MJ0226.2 in the context of its extremophile origin?

Interpreting thermal stability data for MJ0226.2 requires consideration of its hyperthermophilic origins:

  • Contextual interpretation framework:

    • Standard mesophilic protein denaturation models may not apply

    • Activity optima may exist at temperatures that denature testing equipment

    • Stability should be compared to other archaeal proteins, not mesophilic counterparts

  • Recommended analytical approaches:

    • Calculate apparent melting temperatures (Tm) across multiple methods

    • Develop Arrhenius plots to determine activation energies

    • Measure activity retention after heat treatment rather than just structural stability

  • Comparative analysis:

    • Compare stability metrics to homologous proteins from mesophiles

    • Analyze sequence features correlated with thermostability (e.g., increased charged residues)

    • Consider evolutionary context in interpretation

For MJ0226.2, thermal denaturation measured below 80°C may represent non-native conformational changes rather than true denaturation. Activity assays should be conducted at both standard laboratory temperatures and temperatures mimicking native conditions (85-95°C) .

What are the key considerations for designing a research methodology chapter when studying MJ0226.2?

When designing a research methodology chapter for studies involving MJ0226.2, researchers should include:

  • Clear justification of methods:

    • Link protein characteristics to method selection

    • Justify temperature conditions based on protein's thermophilic nature

    • Explain rationale for buffer and detergent selection

  • Comprehensive research approach:

    • Outline the sequential experimental design

    • Describe qualitative, quantitative, or mixed methods approach

    • Detail control experiments and their rationale

  • Detailed protocols with critical parameters:

    • Expression conditions (temperature, induction parameters)

    • Purification strategy with buffer compositions

    • Activity assay conditions with temperature controls

    • Data analysis methods including software and statistical tests

  • Method limitations and challenges:

    • Address temperature stability of equipment and reagents

    • Discuss potential tag interference with protein function

    • Acknowledge technical challenges of working with membrane proteins

The methodology should also include a brief evaluation explaining why certain approaches (e.g., archaeal expression systems vs. E. coli) were chosen over alternatives based on the specific research questions .

How can researchers effectively collaborate on MJ0226.2 studies across institutions?

Effective multi-institutional collaboration on MJ0226.2 studies requires:

  • Standardized protocols:

    • Develop shared standard operating procedures (SOPs)

    • Implement identical protein expression and purification methods

    • Standardize activity assay conditions and readout parameters

  • Material sharing considerations:

    • Establish material transfer agreements (MTAs) early

    • Define shipping conditions for protein samples (dry ice, lyophilized)

    • Consider sharing stable expression clones rather than protein

  • Data management strategies:

    • Implement shared electronic lab notebooks

    • Establish data formatting standards

    • Create centralized repositories for raw experimental data

  • Communication structures:

    • Regular video conference meetings (biweekly recommended)

    • Shared project management tools (Gantt charts, task assignments)

    • Clear publication authorship agreements established upfront

The collaboration should leverage complementary expertise across institutions, with specialized equipment (e.g., high-field NMR, synchrotron facilities) identified at each location and experimental workflows designed to optimize these resources.

What funding strategies are most effective for research projects involving uncharacterized archaeal proteins like MJ0226.2?

Research on uncharacterized archaeal proteins like MJ0226.2 can secure funding through:

  • Targeted funding sources:

    • Basic science foundations supporting fundamental research

    • Extremophile research initiatives

    • Structural biology and membrane protein-specific grants

  • Strategic proposal framing:

    • Position as model system for understanding protein evolution

    • Highlight biotechnological applications of thermostable proteins

    • Connect to fundamental questions in membrane protein biology

  • Collaborative approach:

    • Form multi-institutional teams combining complementary expertise

    • Partner with groups studying related proteins or organisms

    • Include both structural and functional research components

When developing budgets, allocate sufficient resources for specialized equipment capable of high-temperature experiments and consider including funds for archaeal expression systems if native conditions are critical. Success rates are higher when proposals clearly articulate both fundamental science questions and potential long-term applications, even for basic research projects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.