Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0260 (MJ0260)

What is MJ0260 and what are its basic structural features?

MJ0260 is an uncharacterized protein from the archaeon Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440). The full-length protein consists of 203 amino acids with the sequence: MVVLFLIWSHVNVVVSDSMYPIMKRGDLVIVENAGFEFNPNDVDVGDIVVYKAHWPYYQYLLSEIDYKLNLNPYTTLYIFKEGDFKDMSVKVLGEIKTDKSSYKILEADIPKSPTKPVIHRVIDKVEFNNKTYFIIKGDNNPIHDPELVSINQIKQRVIVVDGHPLVIPYVGYLSIWLKEYWYLVVLFVLIYYAYNYLKGGRK . While its specific function remains undetermined, sequence analysis reveals potential membrane-associated regions and possible enzymatic activity sites that warrant further investigation through structural biology approaches.

What are the optimal storage conditions for maintaining MJ0260 stability?

MJ0260 stability is highly dependent on proper storage conditions, which vary based on preparation format. For liquid preparations, the recommended shelf life is 6 months when stored at -20°C to -80°C. Lyophilized preparations demonstrate extended stability with a shelf life of approximately 12 months at the same temperature range . To maintain structural integrity and functional activity, researchers should strictly avoid repeated freeze-thaw cycles, which can lead to protein degradation and activity loss. For short-term experimental use, working aliquots can be maintained at 4°C for up to one week without significant degradation .

What is the recommended reconstitution protocol for lyophilized MJ0260?

For optimal reconstitution of lyophilized MJ0260, follow this methodological approach:

• Briefly centrifuge the vial prior to opening to ensure all material is collected at the bottom

• Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• For long-term storage of the reconstituted protein, add glycerol to a final concentration of 5-50%

• Prepare multiple small-volume aliquots to minimize freeze-thaw cycles

• Store reconstituted aliquots at -20°C to -80°C for maximum stability

The standard glycerol concentration used by manufacturers is typically 50%, which provides optimal cryoprotection while maintaining protein solubility and accessibility for experimental applications.

Which expression systems are employed for recombinant MJ0260 production?

Recombinant MJ0260 production utilizes different expression systems, each with distinct advantages depending on the research application. Current established systems include baculovirus expression systems and bacterial expression in E. coli . These systems represent different methodological approaches to archaeal protein production:

• Baculovirus expression system:

  • Advantages: Superior for complex eukaryotic post-translational modifications

  • Considerations: Longer production timeline, higher cost, potentially more native-like protein folding

• E. coli expression system:

  • Advantages: Rapid production, high yield, cost-effectiveness, established protocols

  • Considerations: Limited post-translational modifications, potential inclusion body formation

The choice between these systems should be guided by specific experimental requirements, including the need for post-translational modifications, quantity requirements, and downstream applications.

How can researchers verify and assess the purity of recombinant MJ0260?

Rigorous quality control is essential when working with recombinant proteins. For MJ0260, commercial preparations typically report purity levels of >85% by SDS-PAGE or >90% for premium preparations . To independently verify purity for critical applications, researchers should implement a multi-method approach:

• Primary analysis: SDS-PAGE with Coomassie or silver staining to visualize major contaminants

• Secondary verification: Western blotting using tag-specific antibodies (for tagged versions)

• Advanced characterization: Size exclusion chromatography to assess aggregation and oligomeric state

• High-resolution analysis: Mass spectrometry to confirm protein identity and detect minor contaminants

For applications requiring exceptional purity, additional purification steps such as ion exchange chromatography or affinity chromatography with the appropriate tag system may be necessary.

What methodologies can researchers employ to determine the structure of MJ0260?

As an uncharacterized protein, elucidating the structure of MJ0260 represents a significant research opportunity. Researchers should consider a comprehensive structural biology approach:

These methods should be applied iteratively, with initial low-resolution structural information guiding more detailed structural studies.

What systematic approaches can identify the function of this uncharacterized protein?

Determining the function of MJ0260 requires a multi-faceted approach that integrates computational prediction with experimental validation:

• Bioinformatic analysis:

  • Sequence alignment with characterized proteins across all domains of life

  • Structural motif identification using conserved domain databases

  • Genomic context analysis to identify operons or functionally related genes

• Biochemical characterization:

  • Activity screening against substrate libraries representing major enzyme classes

  • Binding partner identification through pull-down assays or co-immunoprecipitation

  • Structural substrate docking simulations followed by experimental validation

• Cellular localization and expression:

  • Heterologous expression with fluorescent tags to determine localization patterns

  • Expression analysis under various environmental conditions to identify regulatory patterns

  • Protein-protein interaction network mapping using yeast two-hybrid or proximity labeling

The integration of these approaches increases the probability of functional assignment by creating multiple lines of converging evidence.

How should experiments be designed to study a hyperthermophilic archaeal protein?

M. jannaschii is an extremophilic archaeon that thrives at temperatures near 85°C and pressures exceeding 500 atmospheres . Studying MJ0260 under laboratory conditions requires methodological adaptations to account for these extreme native conditions:

• Temperature considerations:

  • Conduct activity assays across a temperature gradient (37-95°C) to determine optimal temperature

  • Use thermostable reagents and buffers that maintain integrity at high temperatures

  • Consider specialized equipment for high-temperature incubations and measurements

• Buffer optimization:

  • Test various buffer systems that maintain stability at elevated temperatures

  • Include stabilizing agents such as glycerol, specific ions, or osmolytes

  • Adjust pH to account for temperature-dependent shifts in optimal conditions

• Pressure effects:

  • When possible, perform experiments under pressure conditions that mimic the native environment

  • Consider how pressure might affect protein conformation and activity

  • Design control experiments to distinguish temperature and pressure effects

• Experimental controls:

  • Include well-characterized thermostable proteins as positive controls

  • Use mesophilic homologs (if identified) as comparative controls

  • Prepare activity and stability profiles under various conditions to establish baselines

These methodological adaptations ensure that experimental conditions adequately reflect the protein's native environment, increasing the validity of functional assessments.

What strategies can address solubility challenges when working with archaeal proteins?

Archaeal proteins often present solubility challenges when expressed in heterologous systems. For MJ0260, researchers should implement a systematic approach to optimize solubility:

• Expression optimization:

  • Test multiple expression hosts (E. coli strains, yeast systems, insect cells)

  • Vary induction conditions (temperature, inducer concentration, duration)

  • Explore co-expression with archaeal chaperones or folding modulators

• Buffer formulation:

  • Screen different buffer compositions using a factorial design approach

  • Test various salt concentrations to mimic the ionic strength of the native environment

  • Add solubility enhancers such as arginine, proline, or non-detergent sulfobetaines

• Protein engineering:

  • Express with solubility-enhancing tags (MBP, SUMO, thioredoxin)

  • Create truncation constructs to identify soluble domains

  • Implement surface entropy reduction through targeted mutagenesis

• Refolding strategies:

  • Develop protocols for solubilization from inclusion bodies if necessary

  • Optimize refolding conditions through systematic screening

  • Consider on-column refolding methodologies

These approaches should be implemented in a structured manner, with careful documentation of conditions that improve solubility for future reference and reproducibility.

What controls are essential when characterizing the biochemical properties of MJ0260?

Robust experimental design for MJ0260 characterization requires comprehensive controls to ensure valid and reproducible results:

• Protein quality controls:

  • Freshly purified protein vs. stored protein to assess stability effects

  • Tag-cleaved vs. tagged protein to determine tag interference

  • Heat-denatured protein as a negative control

  • Size exclusion chromatography to confirm monodispersity before experiments

• Assay-specific controls:

  • Buffer-only reactions to establish baseline measurements

  • Well-characterized proteins with similar predicted functions as positive controls

  • Related substrates to evaluate specificity

  • Concentration gradients to ensure linearity of responses

• Environmental controls:

  • Temperature series to determine thermal optima and stability

  • pH series to identify optimal reaction conditions

  • Various salt concentrations to mimic archaeal cytoplasmic conditions

  • Time course measurements to ensure steady-state conditions

• Validation controls:

  • Alternative assay methodologies to confirm findings

  • Site-directed mutagenesis of predicted active site residues

  • Inhibitor studies to confirm specificity of observed activities

These controls should be systematically incorporated into experimental designs and reported in publications to ensure scientific rigor and reproducibility.

How can researchers troubleshoot expression and purification issues with MJ0260?

When encountering difficulties with MJ0260 expression and purification, researchers should implement this structured troubleshooting approach:

• Expression troubleshooting:

  • Optimize codon usage for the expression host

  • Adjust induction parameters (IPTG concentration, temperature, duration)

  • Test different growth media formulations

  • Evaluate expression via Western blotting if protein is not visible by SDS-PAGE

• Solubility enhancement:

  • Screen multiple lysis buffer compositions

  • Try alternative cell disruption methods

  • Add stabilizing agents (glycerol, arginine, proline)

  • Consider mild detergents if membrane association is suspected

• Purification optimization:

  • Adjust imidazole concentrations for His-tagged protein

  • Implement step-wise elution protocols

  • Consider ion exchange chromatography as an orthogonal method

  • Optimize buffer conditions throughout the purification process

• Protein quality assessment:

  • Monitor protein stability using thermal shift assays

  • Assess oligomeric state by size exclusion chromatography

  • Check for proteolytic degradation using protease inhibitors

  • Verify intact mass by mass spectrometry

Systematic documentation of troubleshooting steps and outcomes facilitates method optimization and can provide insights into the biochemical properties of the protein.

How can MJ0260 be analyzed in the context of Methanocaldococcus jannaschii's genome?

Analyzing MJ0260 within the context of the complete M. jannaschii genome provides valuable insights into its potential biological role:

• Genomic context analysis:

  • Examine adjacent genes for functional relationships or operonic structures

  • Identify potential regulatory elements in the promoter region

  • Compare with syntenic regions in related archaeal genomes

• Comparative genomics:

  • Analyze the presence or absence of MJ0260 homologs across archaeal species

  • Examine conservation patterns in species with different environmental adaptations

  • Identify co-evolution with other genes suggesting functional relationships

• Transcriptomic integration:

  • Analyze expression patterns under different conditions

  • Identify co-expressed genes that may function in the same pathway

  • Compare expression profiles with genes of known function

The M. jannaschii genome consists of a 1.66-megabase pair chromosome and 58- and 16-kilobase pair extrachromosomal elements, with 1738 predicted protein-coding genes . This genomic context provides a framework for understanding the potential role of MJ0260 within the organism's biology.

What evolutionary insights can be gained from studying archaeal proteins like MJ0260?

Studying archaeal proteins like MJ0260 provides unique evolutionary perspectives:

• Domain architecture analysis:

  • Compare with homologs across all three domains of life

  • Identify archaeal-specific adaptations in sequence and structure

  • Trace the evolutionary history of specific functional domains

• Phylogenetic reconstruction:

  • Build phylogenetic trees to establish evolutionary relationships

  • Identify potential horizontal gene transfer events

  • Analyze rates of sequence evolution to identify functionally constrained regions

• Adaptation mechanisms:

  • Investigate molecular adaptations for thermostability

  • Compare with homologs from organisms in different extreme environments

  • Identify convergent evolution patterns for similar environmental challenges

These evolutionary analyses can place MJ0260 in a broader context of protein evolution and potentially provide insights into ancient protein functions and adaptations.

What are the key specifications for working with recombinant MJ0260?

This comprehensive specification table provides essential reference information for researchers designing experiments with MJ0260, facilitating standardized approaches and reproducible results across different research groups.

What methodological approaches can determine if MJ0260 forms functional complexes?

Determining whether MJ0260 functions as part of a protein complex requires multiple complementary approaches:

• Native state analysis:

  • Blue Native PAGE to identify potential complexes

  • Size exclusion chromatography to determine oligomeric state

  • Analytical ultracentrifugation for precise molecular weight determination

  • Dynamic light scattering to assess homogeneity and approximate size

• Interaction partner identification:

  • Co-immunoprecipitation with potential partners identified through genomic context

  • Proximity labeling in heterologous expression systems

  • Crosslinking mass spectrometry to capture transient interactions

  • Bacterial or yeast two-hybrid screening for systematic interaction mapping

• Structural approaches:

  • Cryo-electron microscopy for larger complexes

  • Small-angle X-ray scattering to determine complex shape in solution

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

• Functional validation:

  • Activity assays comparing isolated protein versus complex

  • Reconstitution experiments with purified components

  • Mutagenesis of predicted interface residues

These methodologies provide multiple lines of evidence for complex formation and can identify the functional significance of protein-protein interactions involving MJ0260.