Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0271 (MJ0271)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0271 (MJ0271) is a bacterially expressed, full-length archaeal protein derived from the hyperthermophilic methanogen Methanocaldococcus jannaschii. This organism, isolated from deep-sea hydrothermal vents, is notable for its role in early genomic sequencing breakthroughs and extremophilic adaptations . The MJ0271 protein remains functionally uncharacterized but is produced recombinantly for structural and biochemical studies .

Genomic Context

  • MJ0271 is encoded by the mj0271 gene, part of the first fully sequenced archaeal genome (1996) .

  • Over 60% of M. jannaschii genes, including mj0271, lack functional annotations, highlighting its value for discovering novel metabolic pathways .

Research Applications

ApplicationDescription
ELISA StudiesCommercial availability as an antigen for antibody detection (e.g., CSB-CF704159MRU) .
Structural BiologyUsed in crystallography and mass spectrometry to resolve archaeal protein folds .
Functional ScreensTarget for genetic engineering in M. jannaschii to study extremophilic adaptations .

Recombinant Production

  • Expression System: Optimized in E. coli for high yield (0.26 mg/L culture reported for homolog Mj-FprA) .

  • Purification: Affinity chromatography (e.g., Streptactin XT columns) ensures homogeneity (>90% purity) .

Industrial Potential

  • Thermostable Enzymes: Proteins like MJ0271 are candidates for biocatalysis in high-temperature industrial processes .

  • Drug Discovery: Structural homology with bacterial proteins aids in designing antimicrobial agents .

Challenges and Future Directions

  • Functional Elucidation: MJ0271’s role in M. jannaschii’s methanogenesis or stress response remains unknown .

  • Optimization: Enhancing soluble expression in mesophilic hosts (e.g., E. coli) for large-scale studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference during order placement. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0271; Uncharacterized protein MJ0271
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0271
Target Protein Sequence
MDLKSNIKLILATDLLAVLILSLFIKNFKMVLAFLLAVFVIWLFIDKNNINERLYENLLA MSVGFIEGILIFLGIIYNEVFLDITLGIFAILILIVMGILFPKYKLIFEVFDEFVEHLKQ KSGFLTLISIFGMLLTIYVFLLILPSKEFCINAVDIIRTIMLVITANMFIIEFYTFKKFS
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0271

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying MJ0271?

Methanocaldococcus jannaschii is a hyperthermophilic methanogenic archaeon originally isolated from deep-sea hydrothermal vents. This organism holds exceptional significance in scientific research as it belongs to a phylogenetically deeply rooted group of methanogens, providing crucial insights into early evolutionary history . M. jannaschii grows optimally at 80°C and produces methane from H₂ and CO₂, making it an excellent model for studying biochemical adaptations to extreme environments .

The significance of M. jannaschii in uncharacterized protein research is further enhanced by its remarkably rapid growth rate, with a doubling time of approximately 26 minutes under optimal conditions, substantially faster than other methanogenic archaea such as M. maripaludis (2 hours) and Methanosarcina acetivorans (8.5 hours) . This characteristic makes M. jannaschii particularly valuable for laboratory studies requiring multiple generations and facilitates more efficient protein production.

The complete genome sequencing of M. jannaschii revealed numerous uncharacterized proteins with no known homologs in bacteria or eukaryotes. These unique proteins, including MJ0271, represent potentially novel biological functions that have evolved to support life in extreme conditions. Studying MJ0271 can therefore provide insights into both archaeal-specific biology and the molecular mechanisms underlying adaptation to extreme environments.

What are the optimal growth conditions for culturing M. jannaschii to study MJ0271?

Growing M. jannaschii under optimal conditions is essential for studying native expression of proteins like MJ0271 and for generating sufficient biomass for protein isolation. Based on established protocols, the following conditions support optimal growth:

ParameterOptimal ConditionNotes
Temperature80°CCan be grown at 65°C for transformation procedures
Growth mediumMedium 1Contains essential salts and minerals
Gas atmosphereH₂:CO₂ (80:20, v/v)Pressurized to 3 × 10⁵ Pa
pH6.0-7.0Maintained with appropriate buffers
Agitation200 rpmIn a shaker incubator
Reducing agentsNa₂S (2 mM), cysteine (2 mM)Added to maintain anaerobic conditions
SupplementsYeast extract (0.1%)Enhances growth rates

For solid medium preparation, researchers should use Gelrite® at a concentration of 0.7% rather than agar, which does not solidify properly at high temperatures . The solid medium should be prepared anaerobically within an anaerobic chamber containing a mixture of N₂, CO₂, and H₂ (76:20:4, v/v/v) .

When culturing M. jannaschii for protein expression studies or transformation, harvest the culture when the optical density at 600 nm reaches 0.5-0.7, corresponding to approximately 2-4 × 10⁸ cells/ml . This represents the optimal cell density for physiological studies and protein isolation. These precise growth parameters are essential for maintaining consistent expression levels of proteins like MJ0271 across experiments.

What approaches can reveal the genomic context of MJ0271?

Understanding the genomic context of uncharacterized proteins like MJ0271 provides critical clues about potential function and regulatory mechanisms. A comprehensive methodological approach should include:

Computational Genomic Analysis:

  • Gene neighborhood examination: Analyze genes flanking MJ0271 within the M. jannaschii genome, as functionally related genes often cluster together in operons.

  • Transcriptional unit prediction: Identify potential promoters, terminators, and other regulatory elements to determine if MJ0271 is part of a polycistronic message.

  • Comparative genomics: Examine conservation of gene order across related archaeal species to identify syntenic regions, which often indicate functional relationships.

  • Regulatory motif identification: Search for conserved DNA motifs in the promoter region that may indicate specific transcription factor binding sites.

Experimental Validation:

  • RT-PCR analysis: Determine if MJ0271 is co-transcribed with neighboring genes by analyzing transcript boundaries.

  • 5' RACE and 3' RACE: Precisely map transcription start and termination sites to define the transcriptional unit.

  • ChIP-seq: Identify proteins that bind to the promoter region of MJ0271 under different conditions.

  • Transcriptome analysis: Compare expression patterns of MJ0271 with neighboring genes across various growth conditions.

This combined approach ensures that genomic context is thoroughly analyzed both computationally and experimentally, providing a solid foundation for functional hypothesis generation about the uncharacterized MJ0271 protein. The genomic neighborhood often contains functionally related genes that can provide the first clues about an uncharacterized protein's biological role.

What genetic manipulation techniques are available for studying MJ0271 in M. jannaschii?

Recent advances have established effective genetic manipulation techniques for M. jannaschii that can be applied to study MJ0271 function. The following methodological approach has been documented:

Transformation Protocol:

  • Grow M. jannaschii cells in liquid medium at 65°C until the culture reaches an optical density of 0.5-0.7 at 600 nm .

  • Harvest cells by centrifugation at 3,000 rpm at room temperature for 10 minutes inside an anaerobic chamber .

  • Resuspend the cell pellet in 500 μl of pre-reduced medium containing sodium sulfide .

  • Incubate the cell suspension at 4°C for 30 minutes .

  • Add 2 μg of linearized plasmid DNA (e.g., suicide vector targeting MJ0271) .

  • Incubate at 4°C for an additional hour .

  • Subject the cells to heat shock by incubation at 85°C for 45 seconds .

  • Incubate at 4°C for 10 minutes .

  • Transfer the transformation mixture to 10 ml of pre-reduced medium supplemented with 0.1% yeast extract .

  • Incubate overnight at 80°C without shaking .

  • Plate 100 μl of culture onto solid medium containing appropriate selection markers .

This heat shock-based transformation method has proven effective for M. jannaschii, with transformation efficiencies of approximately 10⁴ colonies per microgram of plasmid DNA .

Genetic Modification Strategies for MJ0271:

  • Gene knockout: Design suicide vectors with homologous regions flanking MJ0271 for targeted deletion.

  • Promoter replacement: Substitute the native promoter with regulatable promoters to control expression levels.

  • Protein tagging: Introduce affinity tags (e.g., 3xFLAG-twin Strep tag) to MJ0271 for purification and detection .

  • Point mutations: Create specific amino acid substitutions to test structure-function hypotheses.

These genetic tools significantly enhance the potential for characterizing MJ0271 through in vivo studies, allowing researchers to observe the physiological effects of manipulating this gene in its native biological context.

What expression systems are optimal for producing recombinant MJ0271 protein?

Expressing and purifying recombinant MJ0271 from M. jannaschii presents unique challenges due to its thermophilic nature. Researchers can employ two main approaches:

Approach 1: Homologous Expression in M. jannaschii
With the development of genetic systems for M. jannaschii , homologous expression is now feasible:

  • Construction of expression vector: Design a suicide vector containing:

    • Homologous regions for genomic integration

    • A strong promoter (e.g., modified P* promoter)

    • Affinity tag sequence (e.g., 3xFLAG-twin Strep tag)

    • Selectable marker (e.g., mevinolin resistance gene)

  • Transformation: Transform M. jannaschii using the heat shock method described previously .

  • Verification: Confirm successful integration and expression using PCR and Western blotting techniques.

  • Cultivation: Grow the recombinant strain under optimal conditions at large scale (80°C).

  • Protein purification: Harvest cells and purify the tagged MJ0271 using affinity chromatography performed at elevated temperatures to maintain protein stability.

This approach ensures proper folding and potential post-translational modifications, but may yield lower protein quantities compared to heterologous systems.

Approach 2: Heterologous Expression
For higher yields of MJ0271, heterologous expression systems can be employed:

  • E. coli-based expression:

    • Use thermostable E. coli strains (e.g., Arctic Express)

    • Optimize codon usage for E. coli while maintaining the MJ0271 sequence

    • Consider fusion partners that enhance solubility (e.g., SUMO, MBP)

    • Express at lower temperatures (15-30°C) to improve folding

    • Include heat treatment step (60-70°C) during purification to eliminate most E. coli proteins

  • Other archaeal hosts:

    • Consider Thermococcus kodakarensis or Pyrococcus furiosus, which have well-established genetic systems and grow at high temperatures

    • These organisms may provide a more compatible cellular environment for proper folding of MJ0271

Purification Considerations for MJ0271:

  • Perform purification steps at elevated temperatures (50-60°C) to maintain native conformation

  • Include reducing agents to maintain cysteine residues in reduced state

  • Consider detergents or stabilizing agents if membrane association is suspected

  • Verify protein activity immediately after purification at the physiological temperature of M. jannaschii (80°C)

Commercial recombinant proteins from M. jannaschii, such as MJ0738 mentioned in the search results , are typically produced using baculovirus expression systems, which may also be suitable for MJ0271 expression.

What approaches can determine the function of uncharacterized protein MJ0271?

Determining the function of MJ0271 requires a multi-faceted approach combining computational predictions with experimental validation. Here is a comprehensive methodology:

Computational Analysis

  • Sequence-based analysis: Use sensitive homology detection tools (PSI-BLAST, HHpred, HMMER) to identify distant homologs of MJ0271

  • Structural prediction: Employ AlphaFold2 or RoseTTAFold to predict MJ0271 structure, followed by structural comparison against known proteins

  • Genomic context analysis: Examine neighboring genes of MJ0271, which often encode functionally related proteins

  • Phylogenetic profiling: Identify organisms with homologs of MJ0271 and look for patterns of co-occurrence with other genes

  • Protein-protein interaction prediction: Use computational tools to predict potential interaction partners

Experimental Structure Determination

  • X-ray crystallography: Optimize crystallization conditions for thermostable MJ0271

  • Cryo-electron microscopy: Particularly useful if MJ0271 forms larger protein complexes

  • NMR spectroscopy: For smaller domains of MJ0271 or to study dynamics

Biochemical Characterization

  • Enzymatic activity screening: Test MJ0271 for common enzymatic activities based on structural predictions

  • Binding assays: Identify potential ligands, substrates, or interaction partners

  • Thermal stability analysis: Differential scanning calorimetry to identify conditions or ligands that stabilize MJ0271

  • Post-translational modification analysis: Mass spectrometry to identify any modifications

Genetic Approaches

  • Gene knockout: Assess phenotypic changes when MJ0271 is deleted using the genetic systems now available for M. jannaschii

  • Overexpression studies: Evaluate effects of MJ0271 overproduction on cellular physiology

  • Complementation assays: Test if MJ0271 can restore function in heterologous systems with known deficiencies

  • Transcriptional response analysis: RNA-seq to identify genes with altered expression in MJ0271 knockout strains

A robust research question for studying MJ0271 function might be framed as an in-depth exploratory question: "What molecular function does the uncharacterized protein MJ0271 from M. jannaschii perform, and how does this function contribute to the organism's adaptation to extreme environments?" This question is focused, based on literature, realistic in scope, and sufficiently complex to warrant in-depth investigation.

How should temperature and pressure conditions be optimized for MJ0271 functional studies?

Designing experiments for a hyperthermophilic protein like MJ0271 requires special considerations to account for its extreme temperature stability and potential pressure adaptations. Here is a methodological framework:

Temperature Optimization:

  • Activity profiling: Determine the temperature-activity relationship for MJ0271 by testing function across a range (60-95°C) to identify the optimal temperature.

  • Thermal stability analysis: Conduct time-course stability experiments at various temperatures to determine:

    • Half-life at different temperatures

    • Irreversible denaturation thresholds

    • Potential refolding capabilities after thermal stress

  • Buffer selection: Use buffers with minimal temperature-dependent pH changes:

    Buffer TypepH RangeTemperature Coefficient (ΔpK​a/°C)Suitability for MJ0271 Studies
    Phosphate6.8-7.2-0.0028Excellent
    HEPES6.8-8.2-0.014Good
    PIPES6.1-7.5-0.0085Good
    Tris7.5-9.0-0.031Poor (high temp. dependence)

Pressure Considerations:

  • Hydrostatic pressure effects: As M. jannaschii originates from deep-sea environments, consider testing MJ0271 activity under different pressure conditions:

    • Atmospheric pressure (0.1 MPa)

    • Moderate pressure (10-50 MPa)

    • High pressure (>50 MPa)

  • Pressure equipment options:

    • High-pressure stopped-flow apparatus for kinetic measurements

    • Diamond anvil cells for spectroscopic studies under pressure

    • High-pressure bioreactors for cellular studies

Combined Temperature-Pressure Matrix Approach:
Create a systematic experimental design using a temperature-pressure matrix:

  • First, establish baseline activity at atmospheric pressure across temperatures

  • Then, at optimal temperature, test pressure effects

  • Finally, create a full temperature-pressure activity landscape

Specialized Equipment Adaptations:

  • Temperature-controlled reaction vessels: Use jacketed reaction vessels connected to high-temperature circulators

  • Pressure-resistant cuvettes: For spectrophotometric assays under pressure

  • In situ monitoring: Develop fiber optic probes for real-time measurements at high temperature and pressure

  • Rapid sampling devices: To minimize temperature drops during sampling from high-temperature reactions

By systematically addressing these temperature and pressure variables, researchers can design robust experiments that accurately characterize the properties and functions of hyperthermophilic proteins like MJ0271 under conditions that reflect their native environment.

What controls are necessary when conducting functional assays with MJ0271?

When studying an uncharacterized archaeal protein like MJ0271, properly designed controls are essential to ensure the validity and interpretability of experimental results. Here is a comprehensive guide to necessary controls:

Genetic Controls

Control TypePurposeImplementation
Wild-type strainEstablish baseline phenotypeInclude the parental M. jannaschii strain in all phenotypic analyses
MJ0271 deletion strainConfirm protein functionCreate a clean deletion using homologous recombination techniques
Complemented strainVerify phenotype causationReintroduce the wild-type MJ0271 gene on a plasmid or at a different locus
Tagged MJ0271 controlConfirms tag functionalityExpress MJ0271 with the same tag system used in experiments
Negative control strainControls for selection markersTransform with empty vector containing only selection markers

Protein Expression and Purification Controls

  • Expression level verification: Compare MJ0271 levels in wild-type vs. overexpression strains using quantitative Western blotting

  • Solubility controls: Analyze both soluble and insoluble fractions during purification to assess proper folding

  • Purification specificity: Include mock purifications from cells lacking MJ0271 to identify non-specific binding proteins

  • Purity assessment: Perform SDS-PAGE with silver staining and mass spectrometry analysis to confirm homogeneity

  • Activity normalization: Quantify protein concentration using multiple methods (Bradford, BCA, A280)

Functional Assay Controls

  • Substrate specificity: Test multiple potential substrates, including structurally related compounds

  • Enzyme concentration series: Perform assays with varying concentrations of MJ0271 to confirm linear relationship with activity

  • Heat-inactivated MJ0271: Confirm activity loss after extensive heating beyond physiological range (>95°C)

  • Chemical inhibition: Use specific inhibitors if structural predictions suggest vulnerable sites

  • Metal dependence: Test activity in presence of EDTA and with various metal ions if metalloprotein is suspected

Thermal Stability Controls

  • Mesophilic homolog comparison: If available, include a mesophilic homolog of MJ0271 as a control for temperature effects

  • Well-characterized thermophilic protein: Include a well-studied thermophilic protein as a positive control

  • Thermal gradient analysis: Test activity across a temperature range to establish optimal conditions

  • Buffer composition controls: Test multiple buffer compositions to rule out buffer-specific effects at high temperatures

Archaeal-Specific Controls

  • Anaerobic controls: Compare MJ0271 activity under strictly anaerobic vs. microaerobic conditions

  • Salt dependency controls: Test activity across various salt concentrations (0-500 mM KCl)

  • pH controls at high temperature: Measure and adjust for pH changes at experimental temperatures

  • Substrate stability controls: Verify stability of substrates and products at experimental temperatures

When reporting results, researchers should clearly document all controls used and their outcomes to ensure reproducibility and proper interpretation of findings related to MJ0271 function.

How should researchers interpret conflicting functional prediction data for MJ0271?

When faced with conflicting functional predictions for MJ0271, researchers should implement a systematic approach to data interpretation and resolution. This methodological framework helps reconcile discrepancies and guide experimental design:

Step 1: Evaluate Prediction Method Reliability

First, assess the reliability of each prediction method for MJ0271 based on:

Prediction Method TypeReliability Factors to Consider
Sequence homology-based- Alignment coverage percentage of MJ0271
- Sequence identity percentage
- E-value significance
- Number of aligned sequences
Structure-based- Model confidence score (e.g., AlphaFold pLDDT)
- Resolution of template structures
- Structural similarity metrics (RMSD, TM-score)
Machine learning-based- Training dataset composition (inclusion of archaeal proteins)
- Cross-validation performance
- Performance on archaeal proteins specifically
Genomic context-based- Conservation of gene neighborhoods around MJ0271
- Co-occurrence patterns
- Presence in known operons

Step 2: Formulate a Decision Matrix

Create a weighted decision matrix for MJ0271 that incorporates:

  • Method reliability score: Weight predictions from more reliable methods higher

  • Consensus assessment: Give higher weight to functions predicted by multiple methods

  • Evolutionary conservation: Prioritize functions conserved across related archaeal species

  • Physiological relevance: Consider M. jannaschii's metabolism and environmental niche

Step 3: Design Discriminatory Experiments

Design experiments specifically targeting the conflicting predictions for MJ0271:

  • Substrate panel testing: If different enzymatic functions are predicted, test activity with diverse substrates in parallel

  • Binding assays: For predicted binding roles, test interaction with various predicted ligands

  • Structural studies: Focus on active site or binding pocket architecture to distinguish between functional possibilities

  • Genetic approaches: Design phenotypic assays that would differ based on the predicted functions

Step 4: Implement Bayesian Updating

Employ an iterative Bayesian approach:

  • Assign initial probability to each functional prediction for MJ0271 based on prediction reliability

  • Update probabilities as new experimental evidence emerges

  • Design subsequent experiments to target the most probable functions

  • Continue until one function reaches a high probability threshold

Step 5: Consider Multifunctionality

Many archaeal proteins exhibit multifunctionality. Consider whether MJ0271 might:

  • Have multiple distinct functional domains

  • Perform different functions under different conditions

  • Have evolved from a multifunctional ancestor

  • Show moonlighting behavior (secondary functions unrelated to primary function)

Case Study Approach

When formulating a research question to resolve conflicting predictions for MJ0271, follow this template:

"Is the uncharacterized protein MJ0271 primarily functioning as [Prediction A] or [Prediction B], and what biochemical and structural features determine this specificity in the context of M. jannaschii's hyperthermophilic environment?"

This question format meets the criteria for a good research question by being specific, literature-based, realistic in scope, and adequately in-depth .

What statistical approaches are recommended for analyzing MJ0271 functional data?

Analyzing functional assay data for MJ0271 requires statistical approaches that account for the unique challenges of working with extremophilic proteins. Here is a comprehensive guide to statistical analysis:

Experimental Design Considerations

Before applying statistical tests, ensure proper experimental design:

  • Adequate replication: Minimum of 3-5 biological replicates (different MJ0271 preparations) and 2-3 technical replicates per condition

  • Power analysis: Calculate required sample sizes based on expected effect sizes and variability

  • Randomization: Randomize the order of experiments to avoid systematic bias

  • Blinding: When possible, blind the analysis to experimental conditions

Data Preprocessing

  • Outlier detection: Use robust methods such as Grubbs' test or Dixon's Q test

  • Normalization strategies:

    • Activity per unit protein (specific activity)

    • Relative activity compared to optimal conditions

    • Conversion to standard units (μmol/min/mg)

  • Temperature correction: Apply Arrhenius equation to normalize for different assay temperatures

Statistical Tests for Hypothesis Testing

Experimental ScenarioRecommended Statistical TestRobustness Considerations
Comparing MJ0271 activity across temperaturesOne-way ANOVA with post-hoc Tukey HSDConsider non-parametric alternatives (Kruskal-Wallis) if normality is violated
Comparing wild-type vs. mutant MJ0271 activityPaired t-test or Wilcoxon signed-rank testPaired design controls for batch-to-batch variation
Multiple factor analysis (e.g., temperature × pH)Two-way ANOVA with interaction termCheck for homogeneity of variance (Levene's test)
MJ0271 enzyme kinetics parameter comparisonExtra sum-of-squares F-testCompare entire curves rather than individual parameters
Thermal stability comparisonsThermodynamic model fitting with AIC comparisonBootstrap confidence intervals for melting temperatures

Regression Models for Enzyme Kinetics

  • Non-linear regression for fitting MJ0271 enzyme kinetics data:

    • Michaelis-Menten equation for standard kinetics

    • Hill equation for cooperative kinetics

    • Competitive, uncompetitive, or non-competitive inhibition models

  • Model selection using:

    • Akaike Information Criterion (AIC)

    • Bayesian Information Criterion (BIC)

    • F-test for nested models

Specialized Approaches for Thermophilic Enzymes

  • Temperature dependence modeling:

    • Modified Arrhenius plots for MJ0271 activity

    • Equilibrium model fitting for reversible thermal denaturation

    • Statistical comparison of activation energies

  • pH-temperature interaction analysis:

    • Response surface methodology

    • Contour plot analysis

    • 3D visualization of optimal conditions

Reporting Standards

When reporting statistical results for MJ0271:

  • State the specific statistical test used

  • Report exact p-values rather than significance thresholds

  • Include measures of effect size (Cohen's d, η²)

  • Provide confidence intervals for all parameter estimates

  • Justify sample sizes based on power analysis

  • Report all data transformations performed

How might high-throughput technologies advance understanding of MJ0271?

High-throughput technologies offer powerful approaches to accelerate the functional characterization of uncharacterized proteins like MJ0271. Here are key methodological strategies that leverage cutting-edge technologies:

Next-Generation Sequencing Applications

  • RNA-Seq for expression profiling: Identify conditions where MJ0271 is differentially expressed by examining transcriptomic changes across various growth conditions.

  • Ribosome profiling: Determine translation efficiency of MJ0271 and identify potential regulatory mechanisms.

  • ChIP-Seq: Identify transcription factors that regulate MJ0271 expression.

  • Genomic library screening: Create random mutagenesis libraries of MJ0271 and use deep sequencing to identify functional residues through selection experiments.

Proteomic Approaches

  • Mass spectrometry-based interaction proteomics: Identify protein interaction partners of MJ0271 using techniques such as:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) adapted for thermophilic conditions

    • Cross-linking mass spectrometry (XL-MS) optimized for high temperatures

  • High-throughput post-translational modification analysis: Identify modifications of MJ0271 under different growth conditions.

Structural Genomics

  • Cryo-EM screening: Rapidly test multiple buffer and ligand combinations for structural determination.

  • Fragment-based screening: Identify small molecule binders that may reveal functional sites on MJ0271.

  • High-throughput crystallization: Test thousands of crystallization conditions in nanoliter volumes.

Functional Screening Platforms

  • Activity-based protein profiling: Use chemical probes to identify enzymatic activity class.

  • Substrate screening arrays: Test activity against libraries of potential substrates:

    • Carbohydrate arrays

    • Peptide arrays

    • Metabolite collections

  • Phenotype microarrays: Screen MJ0271 knockout or overexpression strains against hundreds of growth conditions to identify functional phenotypes.

Data Integration and Analysis

  • Network analysis: Integrate multiple data types (transcriptomics, proteomics, metabolomics) to position MJ0271 within cellular networks.

  • Machine learning classification: Train algorithms to predict function based on multiple data features.

  • Phylogenetic pattern recognition: Identify co-evolving genes across diverse archaeal species.

Automation and Parallelization

  • Automated protein expression and purification: Test multiple constructs and conditions in parallel.

  • Robotic assay systems: Develop high-temperature compatible automated assay platforms.

  • Microfluidic approaches: Miniaturize assays to increase throughput and reduce sample requirements.

A well-formulated research question leveraging high-throughput approaches might be: "Which high-throughput proteomic and functional genomic methodologies can be optimally combined to systematically identify the biological role of MJ0271 in the context of M. jannaschii's adaptation to extreme environments?" This question is specific, literature-based, realistic with current technologies, and sufficiently in-depth .

What potential biotechnological applications might emerge from MJ0271 research?

Research on uncharacterized proteins like MJ0271 from Methanocaldococcus jannaschii holds significant potential for biotechnological applications, particularly due to the extremophilic nature of this organism. Here's a methodological exploration of these applications:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.