Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0275.1 (MJ0275.1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0275.1 (MJ0275.1) is a protein derived from the archaeon Methanocaldococcus jannaschii . M. jannaschii was the first archaeal genome to be fully sequenced in 1996, marking a significant milestone in genomic research . MJ0275.1 is considered an uncharacterized protein, which means its specific function has not yet been determined through experimentation .

Characteristics

CharacteristicDescription
Full NameRecombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein MJ0275.1 (MJ0275.1)
SourceE. coli
SpeciesMethanocaldococcus jannaschii
TagHis-Tagged
Protein LengthFull Length (1-148 amino acids)
PurityGreater than 90% as determined by SDS-PAGE
UniProt IDP81234
Amino Acid SequenceMCGIMRVYRVYNAYKIVGAVIFSMSIIVILYISIILHSLKLSFSIILAVDILIIALFAYIFLKPKKLVVLDNGIKVDNEFYSWDEVIEFFVSLNSIQINLKGKREETFNWETPGLFKYRPQIEYVVKKDAELLKILREKIENKERKRG
Molecular WeightApproximately 17 kDa
ApplicationsSDS-PAGE, ELISA

Production and Availability

MJ0275.1 is produced recombinantly in E. coli and is available with an N-terminal His tag to aid in purification . It can be purchased from various suppliers for research purposes .

Potential Functions and Interactions

Although MJ0275.1 is currently annotated as an uncharacterized protein, bioinformatic analyses can provide clues to its possible functions. These proteins may participate in various pathways and interact with other proteins and molecules within M. jannaschii . Further experimental studies would be needed to validate these predicted functions and interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0275.1; Uncharacterized protein MJ0275.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0275.1
Target Protein Sequence
MCGIMRVYRVYNAYKIVGAVIFSMSIIVILYISIILHSLKLSFSIILAVDILIIALFAYI FLKPKKLVVLDNGIKVDNEFYSWDEVIEFFVSLNSIQINLKGKREETFNWETPGLFKYRP QIEYVVKKDAELLKILREKIENKERKRG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying archaeal proteins?

Methanocaldococcus jannaschii is a hyperthermophilic methanogen that grows optimally at 80°C and was isolated from deep-sea hydrothermal vents. It represents a phylogenetically deeply rooted archaeon that has been a model system for understanding archaeal biology and evolution. The organism grows using H₂ and CO₂ as substrates for methanogenesis, with an impressively fast doubling time of approximately 26 minutes under optimal conditions . M. jannaschii's significance stems from its position in the tree of life and its adaptation to extreme environments, making its proteins particularly interesting for understanding archaeal biochemistry and evolutionary history. The genome of M. jannaschii was one of the first archaeal genomes to be completely sequenced, revealing numerous uncharacterized proteins with no clear homologs in other domains of life, including MJ0275.1. These proteins may represent novel functions adapted to extreme conditions or ancient protein families that provide insights into early cellular evolution.

What is currently known about the uncharacterized protein MJ0275.1 in M. jannaschii?

MJ0275.1 is classified as an uncharacterized protein in the M. jannaschii genome with no experimentally verified function. Bioinformatic analyses have not identified clear homologs with known functions in other organisms, making it particularly challenging to predict its role. The protein's thermostability, as expected from a hyperthermophilic organism, makes it potentially valuable for biotechnological applications but also complicates functional characterization. Structural predictions may suggest potential binding domains or catalytic sites, though these remain hypothetical without experimental validation. Recent advances in genetic systems for M. jannaschii now provide opportunities to express and study this protein in its native host rather than in heterologous systems that might not support proper folding or post-translational modifications.

How does the study of uncharacterized archaeal proteins like MJ0275.1 contribute to broader scientific understanding?

The study of uncharacterized archaeal proteins contributes significantly to several areas of scientific inquiry. First, it helps fill gaps in our understanding of archaeal metabolism and cellular processes, potentially revealing unique adaptations to extreme environments. Second, archaeal proteins often represent ancestral forms of proteins found in eukaryotes, providing evolutionary insights into the development of complex cellular systems. Third, proteins from hyperthermophiles like M. jannaschii possess remarkable stability properties that can inform protein engineering efforts. Fourth, characterizing novel proteins may reveal new enzymatic activities or molecular mechanisms with potential biotechnological applications. Finally, the study of MJ0275.1 and similar proteins contributes to annotation efforts for archaeal genomes, improving our ability to predict functions based on sequence information and reducing the number of "hypothetical proteins" in genomic databases.

What genetic systems are available for expressing recombinant MJ0275.1 in M. jannaschii?

Recent advances have established viable genetic systems for M. jannaschii that can be applied to study MJ0275.1. A suicide vector-based approach using linearized plasmids has been successfully implemented for homologous gene expression in M. jannaschii . This system allows for double crossover homologous recombination events that can introduce modified genes into the chromosome. For expressing MJ0275.1, researchers can construct a suicide plasmid containing DNA elements representing the upstream and 5′-end coding regions of MJ0275.1 to allow for homologous recombination with the chromosome. The system can incorporate affinity tags such as a 3xFLAG-twin Strep tag for purification purposes and place the modified gene under the control of engineered promoters such as P* for strong expression . This homologous expression system is advantageous over heterologous expression in organisms like E. coli because it provides the native cellular environment, including appropriate chaperones and post-translational modification machinery necessary for proper protein folding and function at high temperatures.

What growth conditions are optimal for expressing MJ0275.1 in M. jannaschii?

Optimal growth conditions for expressing MJ0275.1 in M. jannaschii require careful consideration of several parameters. The organism grows optimally at 80°C in an anaerobic environment with H₂ and CO₂ (80:20, v/v) as methanogenesis substrates . For liquid cultures, serum bottles containing anaerobic and sterile medium are used, pressurized with the H₂ and CO₂ mixture to 3 × 10⁵ Pa, and incubated in a shaker incubator at 80°C and 200 rpm . When expressing recombinant proteins, the growth temperature can be modified to optimize protein folding – for instance, growth at 65°C during transformation has been successful . For solid medium cultivation, which may be useful for clonal isolation following transformation, Gelrite® gellan gum serves as an appropriate gelling agent for hyperthermophiles . The solid medium requires additional reducing agents such as cysteine (2 mM) or titanium (III) citrate (0.14 mM) beyond the standard 2 mM sulfide to support growth . Supplementation with yeast extract (0.1%) can enhance growth rates and colony formation, which is particularly useful when establishing transformed strains expressing recombinant proteins like MJ0275.1.

What transformation protocols can be used to introduce recombinant MJ0275.1 constructs into M. jannaschii?

The transformation protocol for M. jannaschii involves several key steps that have been optimized for this hyperthermophilic organism. First, cells are grown in liquid medium at 65°C until reaching an optical density of 0.5-0.7 at 600 nm (corresponding to 2-4 × 10⁸ cells/ml) . The cells are then harvested inside an anaerobic chamber by centrifugation and resuspended in pre-reduced medium containing sodium sulfide . The transformation process involves a 30-minute incubation at 4°C, addition of linearized plasmid DNA (approximately 2 μg), another 60-minute incubation at 4°C, followed by a heat shock at 85°C for 45 seconds, and a final 10-minute incubation at 4°C . The transformed cells are then cultured overnight at 80°C in medium supplemented with yeast extract (0.1%) without shaking before plating on selective solid medium . This protocol is simpler and less time-consuming than methods used for other methanogens, as it does not require chemical treatments with polyethylene glycol or liposomes . For MJ0275.1 constructs, this transformation procedure would be used to introduce the suicide vector designed for homologous recombination and chromosomal integration of the modified gene.

How can affinity tags be incorporated into MJ0275.1 for purification and characterization?

Affinity tags can be successfully incorporated into recombinant proteins in M. jannaschii, as demonstrated with the FprA protein . For MJ0275.1, a similar approach can be employed using suicide vectors designed for homologous recombination. A common strategy involves fusing a 3xFLAG-twin Strep tag to the N-terminus or C-terminus of MJ0275.1 . The suicide vector would contain the tag sequence together with upstream and partial coding sequences of MJ0275.1 to facilitate double crossover recombination with the chromosome . Following successful transformation and selection, the recombinant strain would express the tagged MJ0275.1 protein, which can then be purified using affinity chromatography. For instance, a Streptactin XT superflow column can be used for purification, with elution achieved using 10 mM D-biotin . This approach allows for one-step purification of the protein with high purity. The incorporation of the FLAG tag also enables detection via Western blotting using commercial anti-FLAG antibodies, which is useful for confirming expression and tracking the protein during purification steps . Mass spectrometric analysis of purified tagged protein can provide additional verification of successful expression and purification.

What bioinformatic approaches can predict potential functions of MJ0275.1?

Advanced bioinformatic approaches offer valuable starting points for predicting potential functions of MJ0275.1 despite its uncharacterized status. Sequence-based methods like PSI-BLAST, HHpred, and hmmsearch can identify distant homologs that might not be detected by standard BLAST searches, potentially revealing functional similarities to characterized proteins. Structural prediction tools such as AlphaFold2 can generate high-confidence structural models that may reveal structural similarities to known protein families even in the absence of sequence similarity. Genomic context analysis examining the organization of genes surrounding MJ0275.1 can provide clues about its functional role, especially if it appears in conserved operons across different archaeal species. Comparative genomics approaches examining the presence or absence of MJ0275.1 homologs across different ecological niches or phylogenetic groups can indicate potential specialized functions related to specific environmental adaptations. Integration of multiple omics datasets, including transcriptomics data revealing co-expression patterns and proteomics data showing protein-protein interactions, can further narrow functional predictions by associating MJ0275.1 with specific cellular processes or stress responses.

How can structural analysis contribute to understanding the function of MJ0275.1?

Structural analysis provides crucial insights for uncharacterized proteins like MJ0275.1 when sequence-based approaches yield limited information. X-ray crystallography remains the gold standard for determining protein structures, though it requires milligram quantities of purified protein and successful crystallization, which can be challenging for archaeal proteins. Cryo-electron microscopy (cryo-EM) offers an alternative approach that may be particularly valuable if MJ0275.1 forms larger complexes or exhibits conformational flexibility. Nuclear magnetic resonance (NMR) spectroscopy can provide structural information in solution state and is especially useful for studying protein dynamics and ligand interactions. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map structural changes upon ligand binding, helping identify potential functional sites even without a complete structure. Computational approaches like molecular dynamics simulations can complement experimental structures by exploring conformational changes and potential binding pockets. Structural analysis may reveal conserved folds associated with specific functions, catalytic triads indicative of enzymatic activities, or binding pockets suggesting potential substrates or interaction partners, all of which narrow the functional possibilities for MJ0275.1.

What experimental approaches are most effective for determining the biochemical function of MJ0275.1?

Determining the biochemical function of an uncharacterized protein like MJ0275.1 requires a comprehensive experimental strategy. Activity-based protein profiling using chemical probes that react with specific active site residues can identify potential enzymatic functions. Metabolite profiling comparing wild-type M. jannaschii with strains overexpressing or lacking MJ0275.1 can reveal metabolic pathways affected by the protein. Substrate screening with libraries of potential metabolites, cofactors, or nucleic acids monitored by techniques such as differential scanning fluorimetry, isothermal titration calorimetry, or surface plasmon resonance can identify binding partners. Protein interaction studies using pull-down assays with the tagged MJ0275.1 followed by mass spectrometry can identify interaction partners that might suggest functional pathways. Gene knockout or knockdown studies, now feasible with the genetic system for M. jannaschii, can reveal phenotypic changes under various growth conditions, providing insights into physiological roles. Complementary approaches such as gene co-expression analysis and transcriptional responses to different stressors can further narrow functional hypotheses by associating MJ0275.1 with specific cellular processes or stress responses in this hyperthermophilic methanogen.

How can high-temperature enzyme assays be designed to characterize the activity of MJ0275.1?

Designing enzyme assays for hyperthermophilic proteins like MJ0275.1 presents unique challenges requiring specialized approaches. Temperature control systems such as heated cuvette holders or high-temperature microplate readers must maintain stable temperatures around 80°C (M. jannaschii's optimal growth temperature) throughout the assay duration . Buffer stability is crucial as common buffers may degrade or change pH significantly at high temperatures; phosphate buffers or specialized thermostable buffers like HEPES with adjusted pKa values for high temperatures are preferred. Substrate stability must be verified at high temperatures, potentially requiring thermostable substrate analogs or monitoring substrate degradation in control reactions. Continuous assays that monitor reaction progress in real-time (like spectrophotometric methods using thermostable cofactors such as F420 that was used for FprA characterization) are preferable to endpoint assays to capture rapid reaction kinetics at high temperatures . Advanced analytical techniques such as high-temperature HPLC, GC-MS, or NMR with heated sample chambers may be necessary for detecting reaction products. Controls must include heat-inactivated enzyme preparations and thermal degradation profiles of all assay components to distinguish enzymatic activity from non-enzymatic thermal reactions that become significant at elevated temperatures.

What are common challenges in expressing recombinant M. jannaschii proteins and how can they be addressed?

Expressing recombinant proteins from hyperthermophiles like M. jannaschii presents several challenges that require specific strategies. Low transformation efficiency can be addressed by optimizing DNA concentrations, heat shock parameters, and using freshly prepared competent cells at the optimal growth phase (OD600 0.5-0.7) . Protein misfolding at non-native temperatures may occur; expressing the protein at various temperatures (65-80°C) can help identify optimal conditions for proper folding . Codon usage bias between expression hosts can impact translation efficiency; this issue is minimized by homologous expression in M. jannaschii rather than heterologous systems . Protein toxicity may arise if the overexpressed protein disrupts normal cellular functions; using tightly regulated promoters or inducible systems can mitigate this effect. Post-translational modifications may be required for proper protein function; homologous expression in M. jannaschii preserves native modification patterns that might be absent in heterologous hosts . Protein instability during purification can occur as thermostable proteins may partially unfold at room temperature; maintaining higher temperatures during purification steps or adding stabilizing agents can help preserve native structure. Low protein yields can be improved by optimizing growth media composition, including yeast extract supplementation (0.1%), and using engineered strong promoters like P* for expression .

How can protein stability be maintained during purification of thermophilic proteins like MJ0275.1?

Maintaining the stability of hyperthermophilic proteins like MJ0275.1 during purification requires specialized approaches to preserve their native conformations. Temperature management throughout the purification process is critical; while room temperature operations are common in protein purification, thermophilic proteins may partially unfold at these temperatures, so maintaining equipment and buffers at elevated temperatures (40-60°C) can preserve stability without causing damage to chromatography resins. Buffer optimization should include stabilizing agents such as glycerol (10-20%), reducing agents to maintain disulfide bonds in their native state, and salt concentrations that mimic the physiological environment of M. jannaschii. Rapid purification protocols minimize the time proteins spend outside their optimal environment; affinity purification using the twin Strep tag system allows for one-step purification with high purity, reducing exposure to potentially destabilizing conditions . Protease inhibitors should be included to prevent degradation, while avoiding metal chelators like EDTA if the protein contains metal cofactors. Storage conditions require careful consideration; flash-freezing in liquid nitrogen with cryoprotectants or lyophilization may be preferable to storage in solution at 4°C for long-term stability. Activity assays performed at different stages of purification can monitor whether the protein retains its native conformation and function throughout the process.

How can researchers address the challenge of functional redundancy when studying uncharacterized proteins in M. jannaschii?

Functional redundancy presents a significant challenge when studying uncharacterized proteins like MJ0275.1, as phenotypic effects may be masked by proteins with overlapping functions. Bioinformatic approaches can identify potential paralogs of MJ0275.1 within the M. jannaschii genome, such as was done for the FprA protein which has two homologs (Mj_0732 and Mj_0748) . Comprehensive sequence and structural comparison between these paralogs can reveal subtle differences in substrate binding sites or catalytic residues that might suggest functional specialization. Multiple gene knockout strategies are powerful for addressing redundancy; with the genetic system now available for M. jannaschii, researchers can construct strains with deletions in multiple related genes to overcome compensatory effects . Conditional expression systems that allow modulation of expression levels can reveal phenotypes that might only become apparent when a protein's abundance falls below a critical threshold. Stress condition screening across various growth conditions (temperature range, nutrient limitation, oxidative stress) may reveal condition-specific functions where redundant proteins show differential expression or activity. Comparative genomics examining the presence or absence of MJ0275.1 homologs across closely related species can identify organisms lacking potential redundant proteins, which might serve as better models for functional characterization. Protein interaction network analysis can distinguish the roles of redundant proteins by identifying unique interaction partners that suggest participation in different cellular processes.

How might systems biology approaches advance understanding of MJ0275.1's role in M. jannaschii?

Systems biology approaches offer powerful frameworks for contextualizing uncharacterized proteins like MJ0275.1 within the broader cellular network. Multi-omics integration combining transcriptomics, proteomics, and metabolomics data can reveal correlations between MJ0275.1 expression and specific metabolic states or stress responses. Genome-scale metabolic models of M. jannaschii can be used to predict the metabolic impact of MJ0275.1 deletion or overexpression, generating testable hypotheses about its function. Protein-protein interaction mapping using techniques like affinity purification-mass spectrometry with tagged MJ0275.1 can identify interaction partners and place the protein within functional complexes or pathways. Network analysis examining the co-expression patterns of MJ0275.1 with genes of known function can suggest biological processes in which the protein participates. Flux balance analysis incorporating experimental data from MJ0275.1 mutant strains can quantify the protein's contribution to metabolic flux distribution. Comparative systems approaches examining how MJ0275.1 homologs function across different archaeal species can reveal evolutionary conservation of systems-level functions. These integrative approaches are particularly valuable for proteins like MJ0275.1 that may have subtle phenotypes or participate in complex multi-protein processes that are difficult to characterize through traditional single-protein biochemical methods.

What are promising applications for thermostable proteins like MJ0275.1 in biotechnology?

Thermostable proteins from hyperthermophiles like M. jannaschii offer unique advantages for biotechnological applications due to their exceptional stability. Industrial biocatalysis could benefit from thermostable enzymes like MJ0275.1 (if found to have catalytic activity) as they enable reactions at higher temperatures, potentially increasing reaction rates, substrate solubility, and reducing microbial contamination risks. Structural biology applications could utilize thermostable proteins as scaffolds for protein engineering, as their robust folding can accommodate significant modifications while maintaining structural integrity. Biosensing technologies could incorporate thermostable proteins for developing detection systems that function reliably in harsh environments or that can be repeatedly denatured and renatured for reuse. Protein therapeutics could benefit from the inherent stability of thermophilic proteins, potentially addressing challenges like limited shelf-life and denaturation during delivery. Bioremediation processes often involve harsh conditions where thermostable enzymes could degrade pollutants more effectively than mesophilic counterparts. Synthetic biology applications could incorporate thermostable proteins as reliable components in designed cellular systems intended to function under challenging conditions. The exact applications for MJ0275.1 would depend on its specific function once characterized, but its thermostability would be an inherent advantage for technological deployment regardless of its native role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.