Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0288 (MJ0288)

Shipped with Ice Packs
In Stock

Description

Physical and Chemical Properties

MJ0288 is lyophilized and stored at -20°C or -80°C. Critical handling guidelines include:

ParameterRecommendation
Storage-20°C/-80°C; aliquot for multiple uses
Freezing/ThawingAvoid repeated cycles; store working aliquots at 4°C for ≤1 week
BufferTris/PBS-based, optimized for stability

Research Applications

While MJ0288’s biological role remains unknown, its recombinant form enables structural and functional studies in archaeal biology:

Functional Hypotheses

  • Metabolic Pathways: M. jannaschii’s genome encodes unique methanogenic cofactors and enzymes, suggesting MJ0288 might participate in hydrogenotrophic methanogenesis or cofactor biosynthesis .

  • ELISA Development: Recombinant MJ0288 is used as an antigen in ELISA kits for detecting specific antibodies, though commercial availability is limited .

Current Research Gaps

MJ0288’s functional characterization lags due to:

  1. Limited Pathway Data: No confirmed involvement in known metabolic pathways (e.g., methanogenesis, amino acid synthesis) .

  2. Interaction Partners: No documented protein interactions or binding partners .

  3. Structural Studies: Crystallographic or NMR data are absent, hindering mechanistic insights.

Future Directions

  • Functional Screens: CRISPR-based gene knockouts in M. jannaschii to assess phenotypic effects .

  • Biochemical Assays: Enzymatic activity tests using MJ0288’s recombinant form.

  • Comparative Genomics: Homology searches across archaeal genomes to identify conserved domains.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0288; Uncharacterized protein MJ0288
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0288
Target Protein Sequence
MKKFSAIFGLLSVIFVIMAISQVSGLSGAITPPKIDIMVNASNGLPQDINSIIYVKNPNS FPVKVEMVTTGDLNNSKKVEVKIMKNNFTLKPGETVGVNITFTVKEKDNYEGDILTKISP VDYGDDKKGVNLKASVVLPTKVAIMVVGNEIHTKELVITAVLIISILGLGAMLIRRHL
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0288

STRING: 243232.MJ_0288

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why are its uncharacterized proteins significant to researchers?

The significance of its uncharacterized proteins stems from several factors. First, as part of the archaeal domain, M. jannaschii contains many genes that are unique to archaea, providing valuable insights into archaeal-specific biochemistry and evolution. Second, its extremophilic nature makes its proteins of interest for biotechnological applications requiring thermostable enzymes. Third, understanding uncharacterized proteins helps complete our knowledge of archaeal metabolic pathways, many of which were first elucidated in this organism .

What genomic features of M. jannaschii contribute to its research importance?

M. jannaschii possesses a large circular chromosome that is 1.66 megabase pairs in length with a G+C content of 31.4%. In addition to its main chromosome, it contains a large circular extra-chromosome and a small circular extra-chromosome .

The genome sequencing of M. jannaschii, completed by Craig Venter's group at TIGR using whole-genome shotgun sequencing, revealed many unique genomic features that provided strong evidence for the three-domain classification of life (Bacteria, Archaea, and Eukarya). Proteomic studies have shown that M. jannaschii contains a remarkably large number of inteins, with one study discovering 19 such protein-splicing elements . These genomic features make M. jannaschii an excellent model organism for understanding archaeal biology and extremophile adaptations.

How does the analysis of uncharacterized proteins from M. jannaschii differ from those of mesophilic organisms?

The analysis of uncharacterized proteins from M. jannaschii requires specialized approaches due to its thermophilic nature. Standard in vitro transcription assays must be optimized for M. jannaschii RNA polymerase, which operates at much higher temperatures than most other transcription complexes .

Researchers must account for the following methodological differences:

AspectMesophilic Protein AnalysisM. jannaschii Protein Analysis
Expression systemsStandard E. coli systems at 37°CThermostable expression systems or modified conditions
PurificationStandard protocolsHeat treatment steps can be used for initial purification
Activity assaysRoom temperature or 37°CMust be conducted at 48-94°C range
Buffer stabilityStandard buffersThermostable buffers resistant to degradation
Structural analysisStandard conditionsMust account for temperature-induced conformational changes

These methodological adaptations are crucial for obtaining biologically relevant data about M. jannaschii proteins and their functions in their native high-temperature environment.

What recombinant protein expression strategies are most effective for M. jannaschii uncharacterized proteins?

The most effective expression strategy for M. jannaschii uncharacterized proteins involves using E. coli as an expression host with specialized vectors designed for thermophilic proteins. The recombinant expression approach should include the following considerations:

  • Codon optimization for E. coli expression while maintaining the thermostability properties of the native protein

  • Use of heat-stable promoters and fusion tags that remain functional during downstream applications

  • Implementation of controlled induction conditions optimized for the particular protein

  • Careful monitoring of protein folding and inclusion body formation

According to available data, recombinant M. jannaschii proteins can be successfully produced in E. coli systems, as evidenced by commercially available products . For experimental work, expression should be followed by a purification strategy that takes advantage of the thermostability of M. jannaschii proteins, such as heat treatment of cell lysates to precipitate host proteins while leaving the thermostable target protein in solution.

What experimental design principles should guide research on uncharacterized archaeal proteins?

When designing experiments for uncharacterized archaeal proteins, researchers should apply robust experimental design principles to ensure valid, reproducible results. Key design considerations include:

  • Power analysis: Calculate the appropriate sample size needed to detect effects with sufficient statistical power. As Quinn and Keough note, "Power analyses can be used to examine different designs and their power to detect different effect sizes" .

  • Randomization and blocking: Implement proper randomization techniques to control for confounding variables, and consider blocking designs to account for known sources of variation .

  • Factorial designs: For investigating multiple factors and their interactions, factorial designs are particularly valuable. These allow for the efficient study of main effects and interactions between experimental factors .

  • Controls and replication: Include appropriate positive and negative controls, as well as technical and biological replicates to ensure reproducibility and reliability of results.

  • Analysis plan: Predetermine statistical analysis methods appropriate for the experimental design, such as ANOVA for factorial or randomized block designs .

A well-structured experimental design might utilize a split-plot or repeated measures design when working with conditions where complete randomization is impractical, such as temperature studies with M. jannaschii proteins .

How can in vitro transcription assays be optimized for studying M. jannaschii proteins?

In vitro transcription assays for M. jannaschii must be specifically optimized to account for the high-temperature requirements of this thermophilic archaeon. According to research on M. jannaschii RNA polymerase:

"Standard in vitro transcription assays can be used to examine the different stages of transcription. [...] These assays have been optimized for M. jannaschii RNA polymerase, which transcribes at much higher temperatures than many other transcription complexes."

Key optimization strategies include:

  • Temperature management: Maintain consistent high temperatures (optimal range 65-85°C) throughout the reaction process

  • Buffer composition: Use buffers that remain stable at high temperatures and contain appropriate salt concentrations to mimic the natural environment

  • Component stability: Ensure all reaction components (nucleotides, primers, templates) are heat-stable

  • Time considerations: Adjust reaction times to account for potentially faster reaction kinetics at higher temperatures

  • Assembly protocol: A fully recombinant approach allows researchers to assemble functional M. jannaschii enzymes from purified components

These optimizations allow for detailed dissection of the different stages of transcription in M. jannaschii, enabling researchers to better understand the function of uncharacterized proteins that may play roles in transcriptional processes.

What computational approaches are most effective for predicting functions of uncharacterized archaeal proteins?

Functional annotation of uncharacterized archaeal proteins relies on an integrated computational approach using multiple bioinformatic tools. Based on successful annotation studies, the most effective computational workflow includes:

  • Physicochemical property analysis: Tools like Expasy's ProtParam program compute properties such as molecular weight, extinction coefficient, isoelectric point, and grand average of hydropathicity (GRAVY) .

  • Domain and motif identification: A combination of tools including InterProScan, Motif, SMART, HMMER, NCBI CDART, and BlastP searches can identify conserved domains that suggest function .

  • Pattern recognition: Using multiple databases improves prediction accuracy. According to research, "functions were successfully assigned to 46 uncharacterized proteins which included enzymes, transporter proteins, membrane proteins, binding proteins, etc."

  • Localization prediction: Subcellular localization prediction tools help determine where a protein functions within the cell.

  • Protein-protein interaction networks: String analysis can reveal interacting partners, providing functional context .

  • Homology-based structure prediction: Servers such as Swiss PDB and Phyre2 can predict protein structures based on homology, offering insights into potential functions .

The efficacy of these approaches can be evaluated using receiver operating characteristics (ROC) analysis, which has shown approximately 83.6% accuracy in function prediction .

What integrated experimental and computational strategies yield the most reliable functional annotations?

The most reliable functional annotations for uncharacterized proteins emerge from integrated approaches that combine computational predictions with experimental validation. An optimal integrated strategy includes:

StageComputational MethodsExperimental ValidationIntegration Approach
Initial predictionSequence analysis, domain prediction-Generate testable hypotheses
Structural analysisHomology modeling, ab initio predictionX-ray crystallography, NMRRefine functional models
Interaction partnersNetwork analysis, co-evolution studiesPull-down assays, Y2H screensDefine functional context
Biochemical functionEnzyme classification predictionActivity assays, substrate screeningConfirm predicted activities
Cellular rolePathway analysis, operon predictionGene knockout, complementationValidate biological relevance

This integrated approach recognizes that computational predictions, while powerful, require experimental validation to achieve high confidence in functional assignments. The success rate of this approach is significantly higher than either method alone, with studies showing that "out of 398 uncharacterized proteins listed in F. nucleatum genome, [researchers] have assigned functions to 39 sequences with high confidence and another 7 with relatively low confidence" . A similar approach would be applicable to M. jannaschii uncharacterized proteins.

How can researchers evaluate the confidence level of predicted protein functions?

Evaluating the confidence of predicted protein functions requires a systematic approach that considers multiple lines of evidence. Researchers should implement the following evaluation framework:

  • Multiple tool concordance: Functions predicted by two or more independent methods carry higher confidence. As noted in one study, "for increasing the accuracy of the results, we assigned the probable function to only those protein sequences whose conserved domains were predicted by two or more databases" .

  • Statistical validation: Use receiver operating characteristics (ROC) analysis to determine the efficacy of prediction methods. Previous studies achieved "an average accuracy of 83% across the parameters" .

  • Evolutionary conservation: Functions conserved across multiple species carry higher confidence than species-specific predictions.

  • Domain architecture analysis: Complete and properly structured domains suggest higher confidence than partial or fragmented domains.

  • Confidence scoring system: Implement a quantitative scoring system combining:

    • Number of supporting methods

    • Statistical confidence of each prediction

    • Quality of matches to reference databases

    • Consistency with known biology of the organism

  • Experimental validation of high-confidence predictions: Prioritize experimental testing of the most confidently predicted functions to validate the prediction methodology.

This framework allows researchers to categorize functional predictions as high, medium, or low confidence, enabling efficient prioritization of experimental validation efforts.

What structural determination methods are most suitable for thermostable archaeal proteins?

Thermostable archaeal proteins present both challenges and opportunities for structural determination. The most suitable methods include:

The selection of the appropriate method depends on protein size, solubility, quantity available, and the specific research questions being addressed. Often, a combination of these methods yields the most comprehensive structural understanding.

How can structural information be used to infer function of uncharacterized proteins?

Structural information provides powerful insights into protein function through multiple analytical pathways:

The integration of structural information with evolutionary conservation data is particularly powerful, as functionally important regions tend to be conserved across species. For M. jannaschii proteins, structural features adapted to high temperatures can also provide clues about their functional roles in extremophilic environments.

What can phylogenetic analysis reveal about the function of uncharacterized M. jannaschii proteins?

Phylogenetic analysis offers critical insights into uncharacterized M. jannaschii proteins through evolutionary context:

  • Ortholog identification: Identifying orthologs across archaea and other domains can suggest conserved functions. M. jannaschii, as the first sequenced archaeon, serves as an important reference point for comparative studies across the archaeal domain .

  • Evolutionary rate analysis: Proteins under strong selective pressure typically evolve slowly, suggesting functional importance. The extremophilic nature of M. jannaschii creates unique evolutionary pressures that shape its proteome.

  • Co-evolution patterns: Proteins that evolve in tandem often function in the same pathway or complex. Network analysis can reveal these relationships, as has been shown through "string analysis to reveal the interacting partners" .

  • Horizontal gene transfer detection: Some uncharacterized proteins may have been acquired through horizontal gene transfer, potentially indicating adaptive functions that conferred fitness advantages in extreme environments.

  • Lineage-specific expansion: Gene families that have expanded in M. jannaschii or related thermophiles may represent adaptations to high-temperature environments.

Phylogenetic analysis is particularly valuable for M. jannaschii as a member of the Methanococci class, with research noting that "Methanocaldoccus jannaschii is a member of the genus Methanocaldococcus (previously a part of Methanococcus) and is therefore sometimes referred to as a 'class I' methanogen" . This taxonomic positioning provides context for understanding the evolutionary history and potential functions of its uncharacterized proteins.

How can comparative genomics approaches identify functional elements in uncharacterized proteins?

Comparative genomics provides multiple strategies for identifying functional elements in uncharacterized proteins:

  • Conserved domain architecture: Analyzing the arrangement of domains across species can reveal functional modules. For M. jannaschii proteins, these comparisons should include other thermophilic archaea as well as mesophilic relatives to distinguish temperature adaptations from core functions.

  • Genomic context analysis: Examining gene neighborhoods can suggest functional relationships. In M. jannaschii, genes in the same operon or genomic vicinity often participate in related metabolic pathways.

  • Phylogenetic profiling: Correlating the presence/absence patterns of genes across species can identify functionally related proteins. This approach has been particularly powerful for identifying components of archaeal-specific metabolic pathways.

  • Signature sequence identification: Detecting sequence motifs unique to functional categories can classify uncharacterized proteins. For thermophilic proteins, specific signatures associated with thermostability can be distinguished from those linked to catalytic functions.

  • Substitution pattern analysis: Analyzing the patterns of amino acid substitutions across homologs can identify functionally critical residues. In M. jannaschii proteins, residues contributing to thermostability versus those essential for function can be differentiated.

These approaches have proven successful in other organisms, with studies showing that "out of 90 HPs with functional domains, functions were successfully assigned to 39 proteins with high confidence" using comparative approaches. Similar success rates could be expected for M. jannaschii uncharacterized proteins when appropriate archaeal comparators are included in the analysis.

What statistical approaches are most appropriate for analyzing experimental data on uncharacterized proteins?

When analyzing experimental data on uncharacterized proteins from M. jannaschii, researchers should employ statistical approaches that account for the complexity and variability inherent in biochemical experiments:

  • Analysis of Variance (ANOVA): For comparing multiple experimental conditions, ANOVA is particularly valuable. As noted by Quinn & Keough, "Single factor (one way) designs" can be used for simple comparisons, while "Factorial designs" allow for examining multiple factors and their interactions .

  • Randomized Complete Block (RCB) designs: These are especially useful when controlling for known sources of variation in protein experiments. "Randomized complete block (RCB) designs" can improve statistical power by accounting for batch effects or other systematic variables .

  • Repeated Measures designs: When taking multiple measurements from the same sample (such as protein activity over time or at different temperatures), repeated measures designs are appropriate. These designs "can be used to examine the different stages of transcription" for M. jannaschii RNA polymerase assays .

  • Power analysis: Critical for determining adequate sample sizes. As described in experimental design literature, power analysis helps "examine the effect size" and ensures experiments have sufficient statistical power to detect meaningful effects .

  • Robust statistical methods: For data that violate assumptions of normality or homogeneity of variance, robust statistical approaches should be employed. Quinn & Keough discuss "Robust ANOVA" options for dealing with heterogeneous variances .

The appropriate statistical approach should be selected based on the specific experimental design, the nature of the data, and the research questions being addressed.

How can researchers ensure reproducibility in studies of archaeal uncharacterized proteins?

Ensuring reproducibility in studies of archaeal uncharacterized proteins requires a comprehensive approach to experimental design, data collection, and reporting:

  • Preregistration of experimental plans: As recommended by open research practices, researchers should "emphasize the need for appropriate experimental Power" and establish analysis plans before collecting data .

  • Standardized protocols: Develop and share detailed protocols for protein expression, purification, and characterization that account for the thermophilic nature of M. jannaschii proteins.

  • Transparent reporting: Follow comprehensive reporting guidelines that include all experimental conditions, especially those critical for thermophilic proteins such as temperature, buffer composition, and salt concentrations.

  • Data sharing: Make raw data, analysis code, and results publicly available through repositories appropriate for protein research.

  • Validation studies: Include internal validation experiments and replicate key findings under varying conditions to demonstrate robustness.

  • Attention to Questionable Research Practices: Follow guidelines that "discusses Questionable Research Practices and how to avoid them" to ensure research integrity .

  • Open Research practices: Implement approaches that "increase transparency and work towards reproducibility" as recommended by current best practices in scientific research .

By integrating these practices, researchers studying uncharacterized proteins from M. jannaschii can build a more reliable and reproducible body of knowledge that advances our understanding of archaeal biology and extremophile adaptations.

What approaches can resolve contradictory experimental data about protein function?

When faced with contradictory experimental data about the function of an uncharacterized M. jannaschii protein, researchers should implement a systematic resolution strategy:

  • Methodological reconciliation: Carefully compare experimental conditions, especially temperature, pH, and buffer composition, which can dramatically affect archaeal protein behavior. Small differences in these parameters may explain contradictory results.

  • Multiple technique validation: Apply orthogonal experimental approaches to test the same functional hypothesis. For example, if structural studies and biochemical assays yield contradictory results, introduce a third method such as genetic complementation or in vivo studies.

  • Condition-dependent function analysis: Investigate whether the protein has different functions under different environmental conditions, a common feature in archaeal proteins that must function across varying extreme conditions.

  • Comprehensive literature review: Systematically analyze all published data using meta-analysis techniques to identify patterns in contradictory results and potential explanatory variables.

  • Collaborative verification: Engage multiple laboratories to independently replicate key experiments using standardized protocols, as recommended by open research practices that "increase transparency and work towards reproducibility" .

  • Computational modeling: Develop in silico models that might explain seemingly contradictory results by accounting for thermodynamic effects, conformational changes, or interaction partners present in different experimental systems.

This systematic approach recognizes that contradictions in experimental data often reflect biological complexity rather than experimental error, particularly for proteins that evolved to function in extreme environments like those inhabited by M. jannaschii.

How can uncharacterized proteins from M. jannaschii contribute to our understanding of early life evolution?

Uncharacterized proteins from M. jannaschii offer unique windows into early life evolution due to the organism's phylogenetic position and extremophilic lifestyle:

  • Archaeal-specific proteins: Many uncharacterized M. jannaschii proteins represent archaeal-specific innovations that can illuminate the distinctive evolutionary path of this domain. As the first archaeon to have its genome sequenced, M. jannaschii revealed "many genes unique to the archaea" .

  • Ancient metabolic pathways: M. jannaschii's methanogenic lifestyle represents one of Earth's oldest metabolic strategies. Its uncharacterized proteins may be components of ancient biochemical pathways that operated in the early anoxic Earth. Research has shown that "many novel metabolic pathways have been worked out in M. jannaschii, including the pathways for synthesis of many methanogenic cofactors" .

  • Adaptations to primordial environments: As a hyperthermophile from deep-sea hydrothermal vents, M. jannaschii's proteins are adapted to conditions that may resemble early Earth environments. Its ability to grow "by making methane as a metabolic byproduct" represents a metabolism potentially available on the early Earth .

  • Molecular fossils: Some uncharacterized proteins may represent molecular fossils—proteins retained from LUCA (Last Universal Common Ancestor) that have diverged beyond recognition in other lineages.

  • Horizontal gene transfer patterns: Analysis of unusual or uncharacterized proteins can reveal ancient horizontal gene transfer events that shaped early evolution. The presence of numerous inteins in M. jannaschii (with "19 discovered by one study" ) suggests complex evolutionary dynamics.

By characterizing these proteins, researchers can reconstruct aspects of early biochemistry and cellular functions that have been obscured by billions of years of evolution in most other lineages.

What insights can structural studies of M. jannaschii proteins provide about protein thermostability mechanisms?

Structural studies of M. jannaschii proteins offer valuable insights into protein thermostability mechanisms that can inform both basic science and biotechnological applications:

  • Amino acid composition patterns: Detailed structural analysis reveals how specific amino acid preferences (increased charged residues, decreased thermolabile residues) contribute to stability at high temperatures without compromising function.

  • Ion pair networks: Three-dimensional structures show how extensive networks of ion pairs (salt bridges) create electrostatic interactions that stabilize proteins at elevated temperatures, often forming cooperative networks rather than isolated pairs.

  • Hydrophobic core packing: Structural studies demonstrate optimized hydrophobic core packing in thermophilic proteins, with M. jannaschii proteins often showing smaller and more tightly packed hydrophobic cores than mesophilic homologs.

  • Conformational rigidity: Analysis of B-factors and molecular dynamics simulations reveals how reduced flexibility in certain regions (while maintaining necessary functional flexibility) contributes to thermostability.

  • Disulfide bond distribution: The strategic placement of disulfide bonds in extracellular or periplasmic proteins provides additional stability against thermal denaturation.

  • Structural adaptations in protein-nucleic acid interactions: Special adaptations in transcription machinery explain how M. jannaschii RNA polymerase "transcribes at much higher temperatures than many other transcription complexes" .

These insights from M. jannaschii proteins have broader implications for protein engineering, particularly for designing thermostable enzymes for industrial applications requiring high-temperature processes.

How might uncharacterized proteins contribute to the unique metabolic capabilities of M. jannaschii?

Uncharacterized proteins likely play crucial roles in the distinctive metabolic capabilities that allow M. jannaschii to thrive in extreme environments:

  • Methanogenesis pathway components: M. jannaschii grows "by making methane as a metabolic byproduct" using "carbon dioxide and hydrogen as primary energy sources" . Uncharacterized proteins may function in novel aspects of this pathway, particularly in coupling methanogenesis to ATP generation under high-pressure, high-temperature conditions.

  • Hydrogenase diversity: The genome includes "many hydrogenases, such as a 5,10-methenyltetrahydromethanopterin hydrogenase, a ferredoxin hydrogenase (eha), and a coenzyme F420 hydrogenase" . Uncharacterized proteins may function as accessory components or regulators of these complex enzyme systems.

  • Novel cofactor biosynthesis: M. jannaschii contains unique pathways for "synthesis of many methanogenic cofactors, riboflavin, and novel amino acid synthesis pathways" . Uncharacterized proteins may catalyze unique steps in these biosynthetic processes.

  • Membrane adaptations: As an archaeon with distinctive membrane lipids, uncharacterized membrane proteins may mediate specific transport processes or membrane stability mechanisms required at high temperatures and pressures.

  • Stress response systems: Uncharacterized proteins may participate in unique stress response pathways that allow survival under fluctuating extreme conditions in hydrothermal vent ecosystems.

  • Energy conservation mechanisms: Given the energetic challenges of life at high temperatures, uncharacterized proteins may contribute to specialized energy conservation mechanisms that maximize ATP yield under thermodynamically challenging conditions.

Characterizing these proteins would significantly enhance our understanding of extremophile metabolism and potentially reveal novel enzymatic activities with biotechnological applications.

What ethical considerations should guide research on thermophilic archaeal proteins?

Research on thermophilic archaeal proteins involves several important ethical considerations that should guide scientific practice:

  • Environmental impact during sample collection: Collection of M. jannaschii samples from deep-sea hydrothermal vents must be conducted with minimal disruption to these unique and delicate ecosystems. The original M. jannaschii samples were collected from "a submarine hydrothermal vent at Woods Hole Oceanographic Institution... at a depth of 2600 m, near the western coast of Mexico" .

  • Transparent reporting of methods: Full disclosure of experimental methods, including failed approaches, prevents unnecessary duplication of research efforts and reduces use of resources.

  • Responsible genetic modification: Research involving genetic modification of M. jannaschii or introduction of its genes into other organisms should include appropriate biosafety measures and consider potential ecological impacts.

  • Equitable benefit sharing: Any commercial applications derived from M. jannaschii research should acknowledge the common heritage aspect of deep-sea resources and consider benefit-sharing mechanisms.

  • Collaborative ethics in extremophile research: Fostering international collaboration, particularly including researchers from regions where similar extremophiles are found, promotes equitable access to research opportunities.

  • Adherence to open science principles: Following open research practices that "increase transparency and work towards reproducibility" ensures that knowledge gained becomes part of the scientific commons, accessible to all researchers.

These ethical considerations align with broader principles of responsible research conduct while addressing the specific context of extremophile research.

What are the best practices for managing research projects on uncharacterized proteins?

Managing research projects on uncharacterized proteins from M. jannaschii requires specialized approaches to navigate the technical challenges and maximize research impact:

  • Integrated experimental design: Implement comprehensive experimental design principles that "emphasize the need for appropriate experimental Power" and include power analysis for all planned analyses . This approach ensures efficient use of research resources.

  • Interdisciplinary team composition: Form teams that combine expertise in bioinformatics, structural biology, biochemistry, and microbiology to address the multifaceted nature of protein characterization.

  • Staged research pipeline: Develop a systematic pipeline that progresses from computational prediction through recombinant expression to functional and structural characterization, with clear criteria for advancing proteins to the next stage.

  • Prioritization framework: Establish clear criteria for prioritizing uncharacterized proteins for study, based on factors such as conservation, predicted essentiality, and potential relevance to archaeal-specific processes.

  • Quality control standards: Implement rigorous quality control measures at each research stage, particularly for recombinant protein production where impurities or misfolding can lead to misleading results.

  • Data management plan: Create comprehensive data management protocols that facilitate data sharing and integration across research stages and between research groups.

  • Open science implementation: Adopt practices that avoid "Questionable Research Practices" and instead "increase transparency and work towards reproducibility" , including preregistration of study designs and open data sharing.

These best practices ensure efficient use of research resources while maximizing the reliability and impact of findings about uncharacterized proteins.

What are the most promising future research directions for M. jannaschii uncharacterized proteins?

The study of M. jannaschii uncharacterized proteins offers several promising research frontiers:

  • Integrated multi-omics approaches: Combining transcriptomics, proteomics, and metabolomics data to contextualize uncharacterized proteins within regulatory networks and metabolic pathways specific to extremophilic growth conditions.

  • Cryo-EM studies of protein complexes: Applying advanced cryo-electron microscopy techniques to visualize archaeal-specific protein complexes that may include uncharacterized components, particularly focusing on the transcription machinery that "transcribes at much higher temperatures than many other transcription complexes" .

  • In situ characterization: Developing methods to study protein function under authentic high-pressure, high-temperature conditions that mimic the native hydrothermal vent environment.

  • CRISPR-based functional genomics: Adapting CRISPR-Cas systems for systematic functional analysis of uncharacterized genes in M. jannaschii or related, more genetically tractable archaea.

  • Ancestral sequence reconstruction: Applying ancestral protein reconstruction methods to infer the properties of archaeal protein predecessors, providing insights into early evolution.

  • Synthetic biology applications: Engineering thermostable M. jannaschii proteins for synthetic biology applications requiring functionality at high temperatures or in harsh conditions.

  • Comparative analysis across extremophiles: Systematic comparison of uncharacterized protein families across different extremophilic archaea to identify common adaptations versus lineage-specific innovations.

These research directions promise to both advance fundamental understanding of archaeal biology and extremophile adaptations while potentially yielding novel enzymes and pathways with biotechnological applications.

How might characterization of these proteins impact our broader understanding of microbial adaptation to extreme environments?

The characterization of uncharacterized proteins from M. jannaschii will significantly expand our understanding of microbial adaptation to extreme environments through several mechanisms:

  • Identification of novel stress response systems: Uncovering previously unknown molecular mechanisms that enable survival under combined stresses of high temperature, high pressure, and variable nutrient availability.

  • Elucidation of extremophile-specific metabolic adaptations: Revealing how core metabolic pathways are modified in extremophiles, particularly the methanogenic pathway that allows M. jannaschii to grow "by making methane as a metabolic byproduct" .

  • Discovery of convergent evolution patterns: Identifying cases where M. jannaschii and unrelated extremophiles have independently evolved similar molecular solutions to environmental challenges.

  • Understanding of protein structure-function relationships: Expanding our knowledge of how proteins maintain functionality under conditions that would denature most mesophilic proteins.

  • Insights into minimal cellular requirements: Clarifying which cellular functions are essential even in extreme environments, contributing to our understanding of the minimal requirements for life.

  • Biomarker development for astrobiology: Identifying potential biosignatures relevant to the search for life in extreme environments on Earth and potentially beyond.

  • Models for climate change adaptation: Providing insights into molecular mechanisms of adaptation to changing environmental conditions, with potential relevance to understanding microbial responses to global climate change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.