Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0332.1 (MJ0332.1)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0332.1 (MJ0332.1) is a protein derived from the archaeon Methanocaldococcus jannaschii. M. jannaschii is a hyperthermophilic methanogen, meaning it thrives in extremely hot environments and produces methane as a metabolic byproduct . MJ0332.1 is referred to as an uncharacterized protein, which indicates that its specific function within the organism is not yet确切的已知 .

Basic Information

CategoryDescription
NameRecombinant Full Length Methanocaldococcus jannaschii Uncharacterized Protein Mj0332.1 (Mj0332.1) Protein, His-Tagged
SourceE. coli
SpeciesMethanocaldococcus jannaschii
SynonymsMJ0332.1, Uncharacterized protein MJ0332.1
UniProt IDP81306
Molecular WeightPredicted ~15 kDa [No relevant source found]
Amino Acid SequenceMMNGENMDKQTVIGFVVLFCVLELVFYLKKLYQSMALTLAVFGIFSLLFFLLYIPVLSKKAVPYVINYFKPPHQRVREIKVGSDETTDNSIIRLKEKAKTLHPDEGNRISGRSSNSFKDSASCIITIVDDSN

Production and Characteristics

MJ0332.1 is produced using recombinant DNA technology, where the gene encoding MJ0332.1 is expressed in E. coli . The recombinant protein is full-length (1-132 amino acids) and includes an N-terminal His tag for purification purposes . The protein is available in lyophilized form . It is recommended to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the option to add 5-50% glycerol for long-term storage at -20°C/-80°C .

Potential Functions and Research Context

As an uncharacterized protein, the exact function of MJ0332.1 remains unknown. Proteins from Methanocaldococcus jannaschii are of interest in various biochemical and genetic studies . Research has focused on understanding the organism's genetic system, including creating strains with modified genes and studying protein activity . For instance, researchers have engineered M. jannaschii strains to overexpress specific proteins with affinity tags, facilitating protein purification and activity testing . Studying uncharacterized proteins like MJ0332.1 may provide insights into unique metabolic pathways or adaptations specific to hyperthermophilic archaea .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
MJ0332.1; Uncharacterized protein MJ0332.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0332.1
Target Protein Sequence
MMNGENMDKQTVIGFVVLFCVLELVFYLKKLYQSMALTLAVFGIFSLLFFLLYIPVLSKK AVPYVINYFKPPHQRVREIKVGSDETTDNSIIRLKEKAKTLHPDEGNRISGRSSNSFKDS ASCIITIVDDSN
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What experimental approaches can determine the function of MJ0332.1?

Given that MJ0332.1 is uncharacterized, a multi-disciplinary approach is necessary to elucidate its function:

ApproachMethodologyExpected OutcomesTechnical Considerations
Bioinformatic AnalysisSequence homology, structural prediction, genomic contextPreliminary functional hypothesesLimited by availability of characterized homologs
Protein-Protein InteractionPull-down assays, Y2H, cross-linking MSIdentification of binding partnersMust account for M. jannaschii growth conditions
Genetic ManipulationGene knockout, complementationPhenotypic effectsRequires genetic tools for M. jannaschii
Biochemical AssaysActivity testing for predicted functionsDirect functional evidenceMust be performed at high temperatures
Structural BiologyX-ray crystallography, Cryo-EM, NMRStructural insightsChallenges in membrane protein crystallization

The recent development of a genetic system for M. jannaschii (as described by Sarmiento et al., 2019) allows for in vivo studies of MJ0332.1 . This genetic system includes:

  • Heat shock-based DNA transformation method

  • Mevinolin/simvastatin selection systems

  • Homologous recombination for genome modification

  • Promoter systems for controlled gene expression

For functional studies, it's crucial to consider the native conditions of M. jannaschii:

  • Optimal growth temperature: 85°C

  • Anaerobic environment

  • Methanogenic metabolism

  • How can structural studies of MJ0332.1 be designed and optimized?

Structural characterization of MJ0332.1 presents unique challenges due to its archaeal origin and potential membrane association:

Structural MethodSample RequirementsAdvantagesLimitations
X-ray CrystallographyHighly pure, homogeneous protein (>95%)High resolution (potentially <2Å)Difficult for membrane proteins
Nuclear Magnetic Resonance (NMR)15N/13C-labeled protein, <30 kDaSolution structure, dynamicsSize limitation (MJ0332.1 is suitable)
Cryo-Electron MicroscopyPure protein, can work with complexesNo crystallization neededTypically for larger proteins/complexes
Small-Angle X-ray ScatteringMonodisperse samplesLow resolution envelope, flexibilityLimited molecular details

For MJ0332.1 crystallization, consider:

  • Detergent screening for membrane protein solubilization

  • Thermostability assays to identify optimal buffer conditions

  • Crystallization at elevated temperatures (20-30°C) to accommodate the thermophilic nature

  • Lipidic cubic phase crystallization if traditional methods fail

  • Addition of stabilizing partners (antibodies, nanobodies) to aid crystallization

NMR studies may be particularly suitable given MJ0332.1's size (132 amino acids), enabling:

  • Backbone assignments

  • Secondary structure determination

  • Dynamics studies

  • Binding site identification through chemical shift perturbation

  • How can genetic manipulation techniques be applied to study MJ0332.1 in vivo?

The recent development of genetic tools for M. jannaschii enables sophisticated in vivo studies of MJ0332.1 :

Genetic TechniqueApplication for MJ0332.1MethodologyConsiderations
Gene DeletionDetermine essentiality and phenotypic effectsHomologous recombination with linearized vectorsRequires P<sub>sla-hmgA</sub> cassette for mevinolin selection
ComplementationVerify phenotype restorationIntroduction of wild-type gene in transRequires shuttle vectors or chromosomal integration
Promoter ReplacementControl expression levelsReplace native promoter with P<sub>flaB1B2</sub> or other controlled promotersEnables regulated expression studies
Affinity TaggingProtein localization and interaction studiesFusion of FLAG, Strep, or other tagsExample: 3xFLAG-twin Strep tag strategy

For generating a MJ0332.1 knockout in M. jannaschii:

  • Construct a suicide plasmid containing 500bp upstream and downstream homology regions

  • Include the P<sub>sla-hmgA</sub> cassette for selection

  • Linearize the construct before transformation

  • Transform M. jannaschii using heat shock (85°C for 5 minutes)

  • Select transformants on solid medium containing mevinolin or simvastatin

  • Verify the knockout by PCR and sequencing

  • Characterize the phenotype under various growth conditions

The transformation efficiency for M. jannaschii is approximately half that observed with laboratory strains, but still sufficient for genetic studies .

  • What strategies can be employed to identify potential interacting partners of MJ0332.1?

Identifying protein-protein interactions is crucial for understanding MJ0332.1's function:

Interaction MethodTechnical ApproachAdvantagesLimitations
Affinity Purification-MSExpress tagged MJ0332.1 in M. jannaschii, purify complexesIn vivo interactions under native conditionsRequires genetic manipulation of M. jannaschii
Cross-linking MSChemical cross-linking followed by MS identificationCaptures transient interactionsPotential artifacts from cross-linking
Yeast Two-HybridScreen against M. jannaschii libraryHigh-throughputLacks physiological context of thermophilic archaea
Proximity LabelingBioID or APEX2 fusions to label nearby proteinsIn vivo spatial contextMay require adaptation for archaeal systems

For affinity purification-MS studies:

  • Generate an M. jannaschii strain expressing MJ0332.1 with a 3xFLAG-twin Strep tag using the genetic system described by Sarmiento et al.

  • Culture the strain under various conditions (different growth phases, stress conditions)

  • Perform gentle lysis preserving protein complexes

  • Purify using tandem affinity purification (Strep-Tactin followed by anti-FLAG)

  • Analyze co-purifying proteins by mass spectrometry

  • Validate interactions through reciprocal pull-downs and functional assays

The recent demonstration of homologous protein expression with affinity tags in M. jannaschii (shown for Mj-FprA) provides a template for similar studies with MJ0332.1 .

  • How can post-translational modifications of MJ0332.1 be analyzed?

Post-translational modifications (PTMs) can significantly impact protein function and may be particularly important in archaea:

PTM Analysis MethodApplicationSensitivitySample Requirements
Mass SpectrometryComprehensive PTM identificationHigh (femtomole)Purified protein, enzymatic digestion
Western BlottingDetection of specific PTMsModerateSpecific antibodies against PTMs
Mobility Shift AssaysDetection of large PTMsLowPurified protein
Chemical DerivatizationTargeting specific PTM typesVariableDepends on modification

For comprehensive PTM analysis of MJ0332.1:

  • Express and purify the protein from both E. coli and native M. jannaschii

  • Perform parallel analysis to identify archaeal-specific modifications

  • Use a combination of proteases (trypsin, chymotrypsin, Glu-C) for maximal sequence coverage

  • Apply enrichment strategies for specific PTMs (phosphopeptide enrichment, etc.)

  • Perform LC-MS/MS analysis with high-resolution instruments

  • Use database search algorithms with archaeal-specific PTM options

Based on studies of other M. jannaschii proteins, potential PTMs to investigate include:

  • Methylation

  • Acetylation

  • Phosphorylation

  • Unique archaeal modifications (similar to cnm<sup>5</sup>s<sup>2</sup>U found in M. jannaschii tRNAs)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.