Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0523 (MJ0523)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please inform us if you have a specific tag type requirement. We will prioritize fulfilling your specified tag request during production.
Synonyms
MJ0523; Uncharacterized protein MJ0523
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0523
Target Protein Sequence
MGEMENIIYSIYHPTILVGFAIGILSLLAIGFQKNDLHALILTDVVECAMLIIIAGVGTD LAEALILPGLVVSLAELLAVSEVLITRKYLKSKRPKPKSYKLFEEFKLPLYTGELKYDIH MEILKTSPKFLAIILIVYGAILSGFTGGAVIATGLLFYALSQRVIGVEISEELKTMWEGI SGLSGIAWALWIFGFIGFFVFPDKWLLCLLMAGLGLVIKVGSKLGLIGYIGEVR
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0523

STRING: 243232.MJ_0523

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0523 and what organism does it originate from?

MJ0523 is an uncharacterized protein from Methanocaldococcus jannaschii, a hyperthermophilic methanogenic archaeon that was the first hyperthermophile isolated from a deep-sea hydrothermal vent . M. jannaschii has significant evolutionary importance as it represents one of the phylogenetically deeply rooted methanogens, deriving energy solely from hydrogenotrophic methanogenesis (4H₂ + CO₂ → CH₄ + 2H₂O) . This metabolic pathway is considered one of the most ancient respiratory metabolisms on Earth, estimated to have developed approximately 3.49 billion years ago . The organism was also the first archaeon for which the complete genome was sequenced, making it a model organism for studying archaea, hyperthermophilic metabolisms, and evolutionary biology .

How can recombinant MJ0523 protein be expressed and purified?

Recombinant MJ0523 can be expressed in heterologous systems such as E. coli with N-terminal His-tags for purification purposes . The typical expression protocol involves:

  • Cloning the MJ0523 gene into an appropriate expression vector

  • Transforming E. coli cells with the construct

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying the protein using immobilized metal affinity chromatography (IMAC)

  • Further purification steps as needed (size exclusion chromatography, ion exchange)

The purified protein is typically obtained as a lyophilized powder and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and store aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles .

What approaches can be used to characterize the function of MJ0523?

As an uncharacterized protein, determining the function of MJ0523 requires multiple complementary approaches:

Structural Analysis:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure

  • NMR spectroscopy for dynamic structural information

  • In silico structural prediction and comparison with known protein families

Biochemical Characterization:

  • Enzymatic activity assays based on predicted functions

  • Protein-protein interaction studies using pull-down assays or yeast two-hybrid

  • Substrate binding assays

  • Post-translational modification analysis

Genetic Approaches:

  • Gene knockout or knockdown studies in M. jannaschii using the genetic system described by Sarmiento et al.

  • Complementation studies in heterologous systems

  • Transcriptomic analysis to identify co-expressed genes

  • Comparative genomics across related archaea species

Functional Genomics:

  • RNA-Seq under various growth conditions to identify expression patterns

  • ChIP-Seq if suspected to interact with DNA

  • Ribosome profiling to assess translation efficiency

How can the genetic system for M. jannaschii be utilized to study MJ0523 in vivo?

The genetic system developed for M. jannaschii allows for targeted manipulation of genes, including MJ0523, enabling in vivo functional studies . The methodology involves:

  • Construction of Suicide Plasmids: Design plasmids containing homologous regions flanking MJ0523 to enable integration into the genome via homologous recombination .

  • Selectable Markers: Incorporate selectable markers such as the mevinolin resistance gene, which has been successfully used in M. jannaschii transformations .

  • Transformation Protocol:

    • Prepare competent M. jannaschii cells for DNA uptake

    • Mix cells with the linearized plasmid DNA

    • Apply heat shock treatment (optimization may be required)

    • Plate on solidified medium containing appropriate selective agents (e.g., mevinolin at 10 μM)

  • Genetic Modifications:

    • Gene knockout: Replace MJ0523 with a selectable marker

    • Tagged expression: Introduce affinity tags (e.g., 3xFLAG-twin Strep tag) for protein purification and localization studies

    • Promoter replacement: Control expression using engineered promoters like P* or PflaB1B2

  • Phenotypic Analysis:

    • Growth rate measurements under various conditions

    • Metabolic profiling

    • Transcriptomic and proteomic comparisons with wild-type

This genetic system typically yields approximately 10^4 mevinolin-resistant colonies per microgram of plasmid DNA , providing sufficient transformants for subsequent analysis.

What are the challenges associated with working with recombinant proteins from hyperthermophilic archaea?

Working with recombinant proteins from hyperthermophilic archaea like M. jannaschii presents several unique challenges:

Protein Folding and Stability:

  • Proteins from hyperthermophiles often require high temperatures for proper folding

  • When expressed in mesophilic hosts like E. coli, misfolding and inclusion body formation are common

  • Chaperone co-expression or in vitro refolding protocols may be necessary

Post-translational Modifications:

  • Archaeal-specific modifications may be absent in bacterial expression systems

  • Some modifications crucial for function may not occur in heterologous hosts

Functional Assays:

  • Enzymatic assays may need to be performed at elevated temperatures (80°C for M. jannaschii proteins)

  • Standard laboratory equipment may not support high-temperature assays

  • Buffer stability and substrate degradation at high temperatures can interfere with results

Structural Studies:

  • Crystallization conditions optimized for mesophilic proteins may not be suitable

  • Flexibility and dynamics different at room temperature versus physiological temperatures (80°C)

Comparative Analysis:

ChallengeSolution ApproachLimitations
Protein misfoldingExpression in archaeal hostsLimited genetic tools for many archaea
Low expression yieldsCodon optimization for hostMay alter protein folding dynamics
Inclusion body formationFusion partners (SUMO, MBP)May interfere with protein function
Lack of archaeal PTMsCell-free expression systemsExpensive, lower yields
Temperature requirementsCustom high-temperature assay systemsIncreased equipment costs

How can structural prediction tools be applied to infer potential functions of MJ0523?

In the absence of experimental structural data, computational approaches can provide valuable insights into MJ0523's potential functions:

  • Sequence-Based Methods:

    • PSI-BLAST to identify distant homologs with known functions

    • Motif scanning against databases like PROSITE and PFAM

    • Transmembrane domain prediction using TMHMM or Phobius (particularly relevant given MJ0523's hydrophobic regions )

  • Advanced Structure Prediction:

    • AlphaFold2 or RoseTTAFold for deep learning-based structure prediction

    • Molecular dynamics simulations at high temperatures to mimic M. jannaschii's physiological conditions

    • Binding site prediction using tools like CASTp or FTSite

  • Functional Inference from Structure:

    • Structural alignment with characterized proteins using DALI or TM-align

    • Identification of catalytic triads or other functional motifs

    • Electrostatic surface mapping to identify potential interaction interfaces

  • Integrative Approaches:

    • Combining genomic context, phylogenetic profiling, and structural predictions

    • Co-evolution analysis to identify potential interaction partners

    • Metabolic pathway reconstruction to place MJ0523 in biochemical context

The predicted structural features can then guide the design of targeted experimental studies to validate the computational hypotheses.

What expression systems are optimal for producing functional recombinant MJ0523?

While E. coli is commonly used for expressing recombinant MJ0523 , several expression systems should be considered for optimal production of functional protein:

Prokaryotic Expression Systems:

  • E. coli: Standard BL21(DE3) or Rosetta strains with T7 promoter-based vectors

    • Advantages: High yields, simple cultivation

    • Limitations: Potential misfolding due to temperature differences

  • Thermophilic bacteria (e.g., Thermus thermophilus):

    • Advantages: Closer to archaeal growth temperatures

    • Limitations: Fewer genetic tools available

Archaeal Expression Systems:

  • Homologous expression in M. jannaschii:

    • Advantages: Native environment, proper folding and modifications

    • Limitations: Lower yields, complex cultivation requirements

  • Other archaea (e.g., Thermococcus kodakarensis, Sulfolobus species):

    • Advantages: Similar cellular machinery, higher cultivation temperatures

    • Limitations: Genetic differences may affect expression

Cell-Free Expression Systems:

  • PURE system supplemented with archaeal components

  • Advantages: Rapid production, controllable conditions

  • Limitations: Higher cost, lower yields

Recommended expression protocol for functional MJ0523:

  • Initial screening in multiple expression systems

  • Optimization of induction parameters (temperature, inducer concentration, duration)

  • Supplementation with specific cofactors if identified through bioinformatic analysis

  • Verification of protein folding using circular dichroism spectroscopy

  • Functional assays at elevated temperatures (70-80°C)

How can researchers investigate the membrane topology and localization of MJ0523?

Based on the amino acid sequence, MJ0523 appears to contain multiple hydrophobic regions characteristic of membrane proteins . To investigate its membrane topology and cellular localization:

Experimental Approaches:

  • Membrane Fractionation:

    • Separate cytoplasmic, membrane, and periplasmic fractions from M. jannaschii

    • Western blot analysis using anti-MJ0523 antibodies

    • Compare distribution in different cellular compartments

  • Protease Accessibility Assays:

    • Treat intact cells or membrane vesicles with proteases

    • Analyze protected fragments to determine transmembrane topology

  • Reporter Fusion Strategies:

    • Create fusion proteins with reporters at N- and C-termini or within predicted loops

    • Examples: GFP, alkaline phosphatase, or β-lactamase fusions

    • Interpret reporter activity/fluorescence based on cellular localization

  • Epitope Tagging and Immunolocalization:

    • Express MJ0523 with epitope tags at different positions

    • Perform immunofluorescence microscopy or immunogold electron microscopy

    • The genetic system for M. jannaschii allows for chromosomal integration of tagged constructs

Computational Analysis to Guide Experiments:

  • Transmembrane prediction tools (TMHMM, Phobius, HMMTOP)

  • Signal peptide prediction (SignalP)

  • Hydropathy plots (Kyte-Doolittle)

  • Amphipathic helix prediction

Combining experimental and computational approaches can generate a comprehensive model of MJ0523's membrane topology, providing insights into its potential role in cellular processes.

What analytical techniques can be applied to study protein-protein interactions involving MJ0523?

Identifying interaction partners of MJ0523 can provide crucial insights into its biological function. Several techniques can be employed:

In Vitro Techniques:

  • Pull-down Assays:

    • Immobilize purified His-tagged MJ0523 on Ni-NTA resin

    • Incubate with M. jannaschii cell lysate

    • Identify binding partners using mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize MJ0523 on sensor chip

    • Flow potential interaction partners and measure binding kinetics

    • Perform at elevated temperatures to mimic physiological conditions

  • Isothermal Titration Calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • Particularly suitable for hyperthermophilic proteins

    • Can provide stoichiometry, affinity, and thermodynamic profile

In Vivo Techniques:

  • Bacterial/Archaeal Two-Hybrid Systems:

    • Adapt standard two-hybrid systems for high-temperature organisms

    • Screen genomic libraries to identify interaction partners

  • Proximity Labeling:

    • Express MJ0523 fused to enzymes like BioID or APEX2

    • Biotinylate proteins in proximity to MJ0523 in vivo

    • Identify labeled proteins by streptavidin purification and mass spectrometry

  • Co-Immunoprecipitation:

    • Express tagged version of MJ0523 in M. jannaschii using the genetic system

    • Immunoprecipitate protein complexes

    • Identify components by mass spectrometry

Crosslinking Mass Spectrometry (XL-MS):

  • Apply crosslinking reagents to stabilize transient interactions

  • Digest crosslinked complexes

  • Identify crosslinked peptides by mass spectrometry

  • Map interaction interfaces

These methods should be performed under conditions that preserve the native structure of MJ0523, potentially including detergents for membrane proteins and elevated temperatures suitable for hyperthermophilic proteins.

How can researchers differentiate between direct and indirect effects in MJ0523 knockout studies?

When analyzing phenotypes resulting from MJ0523 knockout or knockdown, distinguishing direct from indirect effects requires systematic approaches:

Complementation Studies:

  • Reintroduce wild-type MJ0523 to knockout strains

  • Introduce mutated versions affecting specific domains or residues

  • Phenotypic rescue indicates direct relationship

Time-Course Analysis:

  • Monitor changes in cellular processes at multiple time points after inducible knockout

  • Early effects are more likely to be direct consequences

  • Late effects may represent adaptive responses

Multi-Omics Integration:

  • Combine transcriptomics, proteomics, and metabolomics data

  • Construct causal networks using temporal data

  • Identify immediate versus downstream effects

Statistical Approaches for Causality Testing:

  • Bayesian network analysis

  • Structural equation modeling

  • Granger causality testing

Control Experiments:

  • Compare with knockouts of unrelated genes

  • Use graded expression levels rather than complete knockout

  • Employ specific inhibitors if binding partners are identified

Computational Validation:

  • Simulate effects of MJ0523 removal in metabolic models

  • Compare predictions with experimental observations

  • Identify discrepancies requiring further investigation

What considerations should be made when interpreting structural data of hyperthermophilic proteins determined at ambient temperatures?

Structural studies of hyperthermophilic proteins like MJ0523 often occur at ambient temperatures, creating potential discrepancies with their native conformations:

Thermal Adaptation Mechanisms:

  • Increased hydrogen bonding networks

  • Enhanced electrostatic interactions

  • Higher proportion of charged residues

  • More compact hydrophobic cores

Experimental Considerations:

When interpreting structural data, researchers should consider that the physiologically relevant conformation may differ significantly from experimentally determined structures at ambient temperatures.

How might understanding MJ0523 contribute to broader knowledge of archaeal membrane biology?

Research on MJ0523 has potential to advance understanding of archaeal membrane biology in several key areas:

Archaeal Membrane Adaptations:

  • M. jannaschii thrives at temperatures around 80°C and high pressures in deep-sea hydrothermal vents

  • Membrane proteins like MJ0523 may reveal adaptations for maintaining membrane integrity under extreme conditions

  • Could provide insights into unique archaeal membrane lipid interactions

Evolutionary Implications:

  • As a deeply rooted archaeon, M. jannaschii represents early evolutionary adaptations

  • Comparative analysis with bacterial and eukaryotic membrane proteins can illuminate evolutionary trajectories

  • May reveal archaeal-specific membrane protein families and functions

Potential Research Directions:

  • Comparative Genomics:

    • Identify MJ0523 homologs across archaeal lineages

    • Correlate presence/absence with ecological niches

    • Analyze sequence conservation patterns in relation to environmental parameters

  • Functional Characterization:

    • Determine if MJ0523 participates in:

      • Ion transport processes

      • Membrane stabilization

      • Cell division

      • Energy conservation

      • Substrate uptake

  • Biotechnological Applications:

    • Development of thermostable membrane proteins for biotechnology

    • Engineering robust cellular systems for harsh conditions

    • Inspiration for novel nanomaterials based on archaeal membrane structures

What role might MJ0523 play in the methanogenesis pathways of M. jannaschii?

Given that M. jannaschii derives energy solely from hydrogenotrophic methanogenesis , MJ0523 could potentially be involved in this critical pathway:

Possible Functional Roles:

  • Hydrogen or CO₂ Uptake:

    • Membrane localization suggests potential involvement in substrate transport

    • Could facilitate the entry of H₂ or CO₂ into the cell

  • Electron Transfer:

    • May participate in membrane-associated electron transfer processes

    • Could interact with ferredoxins or other electron carriers

  • Proton Translocation:

    • Might contribute to energy conservation through proton translocation

    • Could be part of the machinery generating proton motive force

  • Methane Export:

    • Potential role in facilitating methane efflux from the cell

    • May prevent product inhibition

Experimental Approaches to Test These Hypotheses:

  • Activity Measurements:

    • Monitor methanogenesis rates in MJ0523 knockout strains

    • Measure intermediate accumulation in the methanogenic pathway

  • Localization Studies:

    • Determine if MJ0523 co-localizes with known methanogenesis enzymes

    • Investigate potential protein-protein interactions with methanogenic enzymes

  • Comparative Analysis:

    • Examine correlation between MJ0523 homologs and methanogenesis across archaea

    • Analyze expression patterns under different methanogenic conditions

Understanding MJ0523's potential role in methanogenesis could provide valuable insights into this ancient metabolic pathway and contribute to biotechnological applications for methane production .

What are the most promising research directions for further characterizing MJ0523?

Based on current knowledge and available methodologies, several research directions show particular promise:

  • Integrated Structural-Functional Analysis:

    • Determine the structure of MJ0523 using cryo-EM or X-ray crystallography

    • Combine with functional assays to establish structure-function relationships

    • Perform in silico docking studies to identify potential ligands or substrates

  • Systems Biology Approach:

    • Apply multi-omics techniques to place MJ0523 in cellular context

    • Construct regulatory and metabolic networks including MJ0523

    • Develop predictive models of cellular behavior with and without MJ0523

  • Evolutionary Studies:

    • Trace the evolutionary history of MJ0523 across archaeal lineages

    • Identify conserved features indicating functional importance

    • Reconstruct the ancestral forms of the protein

  • Synthetic Biology Applications:

    • Engineer MJ0523 variants with enhanced properties

    • Incorporate into synthetic pathways for biotechnological applications

    • Develop MJ0523-based biosensors for extreme environments

  • Methodological Advancements:

    • Develop improved genetic tools for M. jannaschii building on existing systems

    • Establish high-throughput screening methods for hyperthermophilic proteins

    • Create specialized assays for membrane protein function at high temperatures

These research directions leverage the current knowledge base while addressing key knowledge gaps, potentially yielding significant insights into archaeal biology, extremophile adaptations, and ancient metabolic pathways.

How can findings from MJ0523 research be applied to broader scientific questions?

Research on MJ0523 can contribute to several broader scientific domains:

Origins of Life and Early Evolution:

  • M. jannaschii represents one of the most ancient lineages of life

  • Understanding its membrane proteins may provide insights into early cellular evolution

  • Could help reconstruct properties of the last universal common ancestor (LUCA)

Extremophile Adaptations:

  • MJ0523 may reveal molecular mechanisms of adaptation to extreme environments

  • Could inform theories about potential extraterrestrial life

  • May provide insights into the limits of biological systems

Biotechnology and Bioremediation:

  • Thermostable proteins like MJ0523 can be valuable industrial catalysts

  • Membrane proteins from extremophiles may inspire new materials science applications

  • Understanding methanogenesis has implications for greenhouse gas mitigation

Synthetic Biology:

  • Engineering minimal cells with archaeal components

  • Developing thermal-resistant biological systems for industrial applications

  • Creating novel metabolic pathways incorporating extremophile proteins

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.