Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0524 (MJ0524)

Shipped with Ice Packs
In Stock

Description

General Information

MJ0524 is a protein from Methanocaldococcus jannaschii, with the gene name MJ0524 and UniProt ID Q57944 . It is also known as Uncharacterized protein MJ0524 . The full-length recombinant protein consists of 158 amino acids .

Table 1: MJ0524 Information

CategoryDescription
SourceMethanocaldococcus jannaschii
SynonymsMJ0524, Uncharacterized protein MJ0524
UniProt IDQ57944
Amino Acid Length158
TagHis

Recombinant MJ0524

Recombinant MJ0524 is produced in E. coli and fused with an N-terminal His tag . The recombinant form is available as a lyophilized powder with greater than 90% purity, as determined by SDS-PAGE . It is recommended to store the protein at -20°C/-80°C upon receipt and avoid repeated freeze-thaw cycles . A Tris/PBS-based buffer with 6% Trehalose at pH 8.0 is used for storage . Reconstitution should be done with deionized sterile water to a concentration of 0.1-1.0 mg/mL, and the addition of 5-50% glycerol is recommended for long-term storage at -20℃/-80℃ .

Genetic Context and Location

The complete genome sequence of Methanococcus jannaschii has been determined, consisting of 1.66-megabase pairs . The mj0524 gene is present within this genome .

Function and Role

As the name implies, the specific function of MJ0524 is currently uncharacterized . Further research is needed to elucidate its precise biochemical role and involvement in cellular processes within Methanocaldococcus jannaschii .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MJ0524; Uncharacterized protein MJ0524
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0524
Target Protein Sequence
MRWVIMKKLGKIWNYLSKPEIVPRIFSVFLALVFIFGLLMPHYLNPNQLYPKPIPHSQTL KTPLAPYDRGGIPLKEPAELKAQYPQYEPNLGKITAYLTPIAEWIKDKTYYFGTTIVSTP GGILDEILYYTRGMDTVLESSILLISFIIFSWLFFNKD
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0524

STRING: 243232.MJ_0524

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is MJ0524 and why is it of research interest?

MJ0524 is an uncharacterized protein from the thermophilic archaeon Methanocaldococcus jannaschii. It consists of 158 amino acids and has been assigned the UniProt ID Q57944 . Research interest in MJ0524 stems from several factors: (1) it belongs to an extremophile organism, which often possess proteins with unique structural and functional properties; (2) understanding the function of uncharacterized proteins contributes to our knowledge of archaeal biology and potentially reveals novel biological mechanisms; and (3) proteins from thermophilic organisms often have biotechnological applications due to their inherent stability at high temperatures. Similar to other hypothetical proteins, functional annotation of MJ0524 may help understand survival mechanisms in extreme conditions and identify novel targets for biotechnological applications .

What are the basic physicochemical properties of MJ0524?

While the search results don't provide specific physicochemical data for MJ0524, researchers typically characterize hypothetical proteins by determining properties such as:

PropertyTypical Analysis Method
Molecular WeightCalculated from amino acid composition
Isoelectric Point (pI)Computed based on charged residues
GRAVY (Grand Average of Hydropathy)Indicates protein solubility
Aliphatic IndexProvides information about thermostability
Instability IndexPredicts protein stability in test tubes

These properties can be determined using tools like ProtParam (ExPASy) as part of the initial characterization process. Based on the sequence, MJ0524 appears to contain hydrophobic regions, suggesting potential membrane association, as indicated by segments like "VFIFGLLMPH" in its sequence .

How can I express and purify recombinant MJ0524 for experimental studies?

For recombinant expression of MJ0524, the established method involves:

  • Cloning the full-length MJ0524 gene (encoding amino acids 1-158) into an expression vector with an N-terminal histidine tag

  • Transforming the construct into an Escherichia coli expression system

  • Inducing protein expression under optimized conditions

  • Purifying using immobilized metal affinity chromatography (IMAC) targeting the His-tag

  • Further purification, if needed, using size exclusion chromatography or ion exchange chromatography

The purified protein can be obtained in the form of a lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding 5-50% glycerol (final concentration) and storing at -20°C/-80°C in aliquots is recommended. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What expression systems are most effective for producing functional MJ0524?

  • Codon optimization for the expression host to enhance protein yields

  • Testing multiple expression strains (BL21(DE3), Rosetta, Arctic Express) to identify optimal production conditions

  • Evaluating different induction temperatures (especially lower temperatures of 16-18°C) to improve protein solubility

  • Exploring archaeal expression systems for native folding if functional studies indicate issues with E. coli-expressed protein

When working with hypothetical proteins like MJ0524, it's advisable to perform functional validation of the recombinant protein to ensure that the heterologous expression system produces properly folded, biologically active protein, especially considering the significant phylogenetic distance between archaea and bacteria.

How can I predict the three-dimensional structure of MJ0524?

For predicting the 3D structure of MJ0524, researchers should employ multiple complementary approaches:

  • Homology modeling using SWISS-MODEL if homologous proteins with known structures exist

  • Ab initio structure prediction using AlphaFold, which has demonstrated accuracy comparable to or better than experimental methods for many proteins

  • Validation of predicted structures using Ramachandran plots and quality scores

  • Structural comparison with known proteins using Needleman-Wunsch algorithm to infer functional similarities

  • Visualization using tools like UCSF Chimera or PyMOL for structural analysis

The quality of structure predictions should be evaluated using metrics such as QMEAN, MolProbity scores, and the percentage of residues in favored regions of Ramachandran plots . For uncharacterized proteins like MJ0524, comparing structures predicted by different methods (e.g., SWISS-MODEL vs. AlphaFold) can provide additional confidence in the predicted fold, as demonstrated for other hypothetical proteins .

What structural domains or motifs might be present in MJ0524?

While specific domain information for MJ0524 is not provided in the search results, researchers studying uncharacterized proteins typically conduct the following analyses:

  • Sequence-based domain prediction using tools like Pfam, InterPro, SMART, and CDD-BLAST

  • Structural motif identification using the predicted 3D structure

  • Comparison with known protein families in databases like CATH and SUPERFAMILY

  • Analysis of conserved residues across homologous proteins

  • Identification of potential binding sites or catalytic residues based on structural patterns

The presence of hydrophobic segments in the MJ0524 sequence suggests possible transmembrane regions or membrane association , which should be further investigated using specialized prediction tools such as TMHMM or Phobius.

What computational approaches can help predict the function of MJ0524?

A comprehensive approach to functionally annotate MJ0524 should include:

  • Sequence-based homology searches against characterized proteins using BLAST, PSI-BLAST

  • Functional domain identification using Pfam, InterPro, CATH, SUPERFAMILY, SMART, CDD-BLAST, and SCANPROSITE

  • Protein-protein interaction (PPI) prediction using the STRING database to understand the protein's role in biological networks

  • Structural comparisons with functionally characterized proteins

  • Gene neighborhood analysis to identify functionally related genes

  • Subcellular localization prediction

This multi-tool approach has demonstrated high accuracy (98%) in functional annotation of hypothetical proteins in other organisms . For MJ0524 specifically, these methods could provide insights into whether it's involved in processes like stress response, membrane transport, or metabolic functions, which are common roles for proteins in extremophilic archaea.

How can protein-protein interaction studies help understand MJ0524's function?

Protein-protein interaction (PPI) studies are essential for uncharacterized proteins like MJ0524 because they provide context for the protein's biological role. Methodological approaches include:

  • In silico PPI prediction using the STRING database to identify potential interaction partners based on genomic context, co-expression, and text mining

  • Experimental validation using techniques such as:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation with candidate partners

    • Pull-down assays using the recombinant His-tagged MJ0524

    • Crosslinking mass spectrometry to identify transient interactions

  • Network analysis to place MJ0524 in specific biological pathways

  • Correlation with gene expression data to identify conditionally co-expressed genes

Understanding the interaction network of MJ0524 can lead to inferences about its biological functions and place it within the cellular machinery of Methanocaldococcus jannaschii . This approach has successfully contributed to functional annotation of other hypothetical proteins in various organisms.

How can I design experiments to validate predicted functions of MJ0524?

To validate predicted functions of MJ0524, researchers should design experiments that specifically test hypothesized activities:

  • If structural analysis suggests enzymatic activity:

    • Design substrate screening assays based on predicted enzyme class

    • Perform site-directed mutagenesis of predicted catalytic residues

    • Conduct kinetic analyses with potential substrates

  • If membrane association is predicted:

    • Perform membrane fractionation experiments

    • Conduct lipid binding assays

    • Use fluorescently tagged MJ0524 for localization studies

  • If protein-protein interactions are predicted:

    • Validate specific interactions using co-immunoprecipitation

    • Perform mutational analysis of predicted interaction interfaces

    • Use FRET or BRET to detect interactions in vitro or in heterologous systems

  • If stress response functions are predicted:

    • Express MJ0524 in model organisms and test resistance to relevant stressors

    • Examine expression levels of MJ0524 under different stress conditions

    • Test the effect of MJ0524 deletion or overexpression on stress survival

These experimental approaches should be designed with appropriate controls and quantitative readouts to provide conclusive evidence for or against predicted functions.

What are the challenges in studying archaeal uncharacterized proteins like MJ0524?

Researchers face several methodological challenges when studying archaeal uncharacterized proteins:

  • Phylogenetic distance from model organisms:

    • Limited applicability of functional prediction tools primarily trained on bacterial and eukaryotic proteins

    • Possible novel protein folds or functions not represented in current databases

  • Extremophile-specific considerations for MJ0524:

    • Need for specialized conditions to maintain native structure (temperature, salt concentration)

    • Difficulty in replicating the native environment of a thermophilic archaeon

  • Technical challenges:

    • Potential protein misfolding when expressed in mesophilic hosts like E. coli

    • Need for specialized equipment for high-temperature enzymatic assays

    • Limited genetic tools for manipulation of the native organism

  • Validation challenges:

    • Difficulty in obtaining knockout strains in the native organism

    • Limited availability of antibodies or other detection reagents specific to archaeal proteins

Addressing these challenges requires interdisciplinary approaches and specialized techniques adapted to archaeal biology and the extreme conditions in which these organisms thrive.

How does the approach to studying MJ0524 compare with strategies for other hypothetical proteins?

The methodological approach to studying MJ0524 follows a similar framework to that used for other hypothetical proteins, but with considerations specific to archaeal proteins:

AspectGeneral Approach for HPsSpecific Considerations for MJ0524
Sequence AnalysisHomology searches, domain predictionNeed for archaeal-specific databases
Structural PredictionHomology modeling, ab initio predictionAdaptation to thermophilic properties
Functional AnnotationMulti-tool approach, PPI predictionIntegration with archaeal metabolic pathways
Experimental ValidationRecombinant expression, activity assaysHigh-temperature conditions for assays
Evolutionary AnalysisPhylogenetic profilingConsideration of archaeal evolutionary context

Successful annotation of hypothetical proteins, as demonstrated with Bacillus paralicheniformis strain Bac84, shows that a structured in-silico approach can attribute functions to previously uncharacterized proteins with high accuracy . For MJ0524, the same principles apply, but with careful attention to its archaeal origin and potential thermophilic adaptations.

What can we learn from successfully characterized hypothetical proteins in other organisms?

Studies of hypothetical proteins in other organisms provide valuable methodological insights for MJ0524 research:

  • Success rates and methodologies:

    • In Bacillus paralicheniformis, 37 out of 414 hypothetical proteins (8.9%) were successfully functionally annotated using a multi-tool approach

    • Performance evaluation showed 98% accuracy for the tools used, validating the methodology

  • Types of functions discovered:

    • Adaptational roles such as sporulation, biofilm formation, motility, and transcription regulation

    • Biotechnological potentials including biosynthesis pathways and bioremediation

    • Structural roles and involvement in stress responses

  • Structure-function relationships:

    • For some proteins, tertiary structure predictions validated functional annotations

    • Comparison of Swiss-Model and AlphaFold predictions showed concordance, increasing confidence in structural models

These successes demonstrate that systematic approaches combining multiple bioinformatics tools and selected experimental validations can effectively characterize proteins like MJ0524, potentially leading to discoveries about survival mechanisms in extreme environments and novel biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.