Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0545 (MJ0545)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0545; Uncharacterized protein MJ0545
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0545
Target Protein Sequence
MVGKMKKVIIPLLISLFIFLIPNYALNPEIIVTPEKCLVNNSVYVIFQWRAPYNVEDFNV TVLSDAVVFKNSTLYYAGVAEDAKVFHIFEGEAVTPGNHTINVQMSYIIDGTLIKKKFLL NISILTLPENIYVSYNNTYNRDEENTSLLENITKIFENTTNVTTPNSTNAIINETNITQN KTNISKNIDIGNITKANTTSQEKITQKFNNTSTQTIENVQKDKGNNWLMYGILGLIIGIV FGFVVMYIIKI
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0545

STRING: 243232.MJ_0545

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii Uncharacterized protein MJ0545?

Methanocaldococcus jannaschii Uncharacterized protein MJ0545 is a 251-amino acid protein encoded by the MJ0545 gene in the genome of the hyperthermophilic archaeon Methanocaldococcus jannaschii. The protein has a UniProt ID of Q57965 and is part of the 1.66-megabase pair genome sequence of this autotrophic archaeon . Despite being identified during the complete genome sequencing of M. jannaschii, the physiological function of MJ0545 remains uncharacterized, making it an interesting target for structural and functional genomics research. The protein is classified as "uncharacterized" because its biological role, enzymatic activity, and cellular localization have not yet been definitively established through experimental approaches.

What are the optimal storage conditions for recombinant MJ0545 protein?

Recombinant MJ0545 protein should be stored according to the following protocol to maintain stability and activity:

  • Upon receipt, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (range of 5-50% is acceptable)

  • Aliquot the solution to minimize freeze-thaw cycles

  • Store at -20°C/-80°C for long-term storage

  • For working stocks, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they may lead to protein denaturation

These storage recommendations are based on standard protocols for thermostable archaeal proteins and are designed to preserve the native structure and activity of MJ0545.

How should I design experiments to characterize the function of MJ0545?

Designing experiments to characterize the function of an uncharacterized protein like MJ0545 requires a systematic approach incorporating multiple experimental strategies:

  • Bioinformatic Analysis:

    • Conduct sequence homology searches using BLAST against characterized proteins

    • Perform domain prediction using tools like Pfam, SMART, and InterPro

    • Apply structural prediction using AlphaFold or similar tools

  • Expression System Selection:

    • Select an appropriate heterologous expression system (E. coli is commonly used, as with other M. jannaschii proteins)

    • Design constructs with appropriate tags for purification and detection

    • Consider expression at different temperatures to maintain proper folding

  • Functional Screening Approaches:

    • Enzymatic activity assays based on predicted functions

    • Protein-protein interaction studies using pull-down assays or yeast two-hybrid

    • Cellular localization studies using tagged constructs

  • Experimental Controls:

    • Include positive controls with known activities

    • Use negative controls (e.g., inactive mutants) to validate assay specificity

    • Implement technical replicates to ensure reproducibility

When designing these experiments, follow best practices in experimental design by clearly defining variables and controlling for confounding factors . Your experimental design should include both independent variables (e.g., protein concentration, substrate concentration) and dependent variables (e.g., enzymatic activity, binding affinity) with appropriate controls .

What expression systems are recommended for recombinant MJ0545 production?

Based on successful expression of other M. jannaschii proteins, the following expression systems are recommended for recombinant MJ0545 production:

Expression SystemAdvantagesLimitationsTag Options
E. coli BL21(DE3)High yield, simple cultivation, widely used for archaeal proteinsMay not reproduce archaeal post-translational modificationsHis-tag, GST, MBP
E. coli RosettaEnhanced expression of proteins with rare codonsLower yield than BL21His-tag, GST, MBP
Archaeal host systemsNative folding environment, natural post-translational modificationsMore complex cultivation, lower yieldsHis-tag

For MJ0545 specifically, E. coli expression systems have been successfully used with N-terminal His-tags, as documented in commercial protein preparations . The MJ0044 gene from M. jannaschii was similarly expressed in E. coli using pT7-7 plasmid after PCR amplification with specific primers, and this approach could be adapted for MJ0545 .

The recommended approach is to:

  • Amplify the MJ0545 gene by PCR from genomic DNA

  • Clone into an expression vector (e.g., pET series) with an appropriate tag

  • Transform into E. coli BL21(DE3) or Rosetta strains

  • Induce expression with IPTG at lower temperatures (25-30°C) to enhance proper folding

  • Purify using affinity chromatography based on the selected tag

How can I address potential contradictions in experimental results when working with MJ0545?

When encountering contradictory results in experiments with uncharacterized proteins like MJ0545, apply a systematic approach to identify and resolve discrepancies:

  • Document and categorize contradictions using a structured notation system:

    • Identify the number of interdependent variables (α)

    • Determine the number of contradictory dependencies (β)

    • Calculate the minimal number of required Boolean rules to assess these contradictions (θ)

  • Analyze potential sources of contradictions:

    • Experimental conditions (temperature, pH, buffer composition)

    • Protein quality (purity, folding, post-translational modifications)

    • Methodological differences between studies

    • Biological variability in different expression systems

  • Resolution strategies:

    • Perform validation experiments with standardized protocols

    • Use multiple complementary techniques to confirm findings

    • Implement context analysis to determine if contradictions are due to incomplete context specification

  • Apply the Jadad algorithm for assessing discordance across experimental results:

    • Compare sources of inconsistency including differences in experimental questions, inclusion criteria, data extraction methods, and statistical analysis approaches

    • Create a decision tree to systematically evaluate sources of contradiction

When reporting contradictory results, explicitly document all experimental conditions and methodological details to facilitate future resolution of discrepancies .

What bioinformatic approaches can help predict MJ0545 function?

Advanced bioinformatic approaches can provide valuable insights into the potential function of MJ0545:

  • Sequence-Based Analysis:

    • Remote homology detection using PSI-BLAST and HHpred

    • Evolutionary analysis using multiple sequence alignments of homologs

    • Identification of conserved motifs and functional residues

  • Structural Prediction and Analysis:

    • Utilize AlphaFold2 or RoseTTAFold for accurate 3D structure prediction

    • Analyze structural features using molecular visualization tools

    • Perform structure-based function prediction using tools like ProFunc or COFACTOR

  • Genomic Context Analysis:

    • Examine the genomic neighborhood of MJ0545 for functionally related genes

    • Look for conserved gene clusters across related species

    • Analyze co-expression patterns if transcriptomic data is available

  • Integrated Functional Prediction:

    • Combine multiple lines of evidence using integrative platforms like STRING

    • Apply machine learning approaches trained on characterized proteins

    • Use molecular docking to predict potential binding partners or substrates

These computational approaches can generate testable hypotheses about MJ0545 function, which can then be validated through experimental methods. Since MJ0545 is annotated as "uncharacterized," these predictions are essential for guiding initial experimental characterization efforts.

How should I design factorial experiments to investigate MJ0545 interactions with environmental factors?

Factorial experimental designs are particularly valuable for investigating how MJ0545 function might be influenced by multiple environmental factors typical of M. jannaschii's extreme habitat:

An example 2^3 factorial design for investigating temperature, pH, and salt concentration effects on MJ0545 activity:

ExperimentTemperature (°C)pHNaCl (mM)Measured Response
170 (-)5.5 (-)100 (-)Activity 1
295 (+)5.5 (-)100 (-)Activity 2
370 (-)8.0 (+)100 (-)Activity 3
495 (+)8.0 (+)100 (-)Activity 4
570 (-)5.5 (-)500 (+)Activity 5
695 (+)5.5 (-)500 (+)Activity 6
770 (-)8.0 (+)500 (+)Activity 7
895 (+)8.0 (+)500 (+)Activity 8

This approach allows for systematic investigation of both main effects and interaction effects between factors, providing a comprehensive understanding of how MJ0545 responds to different environmental conditions .

What methods are available for studying potential protein-protein interactions involving MJ0545?

Investigating protein-protein interactions of uncharacterized proteins like MJ0545 requires specialized approaches that can handle the challenges of archaeal proteins:

  • In vitro methods:

    • Pull-down assays using recombinant His-tagged MJ0545

    • Surface plasmon resonance (SPR) for quantitative binding analysis

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Cross-linking mass spectrometry to identify interaction interfaces

  • Computational prediction approaches:

    • Structure-based protein-protein interaction prediction

    • Co-evolution analysis to identify potential interaction partners

    • Genomic context methods (gene neighborhood, gene fusion)

  • Advanced cellular methods:

    • Bacterial two-hybrid systems adapted for archaeal proteins

    • Proximity-dependent biotin identification (BioID) in heterologous systems

    • Co-immunoprecipitation followed by mass spectrometry

  • Validation approaches:

    • Mutational analysis of predicted interaction interfaces

    • Competition assays with predicted binding partners

    • Structural studies of complexes using X-ray crystallography or cryo-EM

These methods can be applied in a sequential workflow, starting with computational predictions to identify candidate interactors, followed by in vitro validation, and finally cellular studies to confirm physiological relevance. The challenge with archaeal proteins is that standard assays may need to be modified to account for the unique properties of these proteins, particularly their thermostability and possible requirements for extreme conditions.

How can repeated measures designs be implemented for studying MJ0545 stability under different conditions?

A repeated measures experimental design is particularly valuable for studying the stability of MJ0545 under various conditions while controlling for batch-to-batch protein variation:

  • Design principles:

    • Each batch of MJ0545 serves as its own control across different conditions

    • Reduces error variance caused by individual protein preparation differences

    • Allows for more powerful statistical analysis with fewer protein preparations

  • Implementation steps:

    • Prepare a large batch of homogeneous MJ0545 protein

    • Divide into equal aliquots for exposure to different conditions

    • Measure stability parameters at predetermined time points

    • Use appropriate statistical methods for repeated measures data

  • Addressing assumptions:

    • Test for sphericity using Mauchly's test when analyzing data

    • Apply corrections (Greenhouse-Geisser or Huynh-Feldt) if sphericity is violated

    • Consider robust repeated measures analyses for non-normal data

  • Example protocol:

    a. Prepare recombinant MJ0545 according to standard protocols
    b. Divide into equal aliquots and expose to different conditions:

    • Temperature range (25°C, 37°C, 60°C, 80°C, 95°C)

    • pH conditions (pH 5, 6, 7, 8, 9)

    • Denaturant concentrations (0, 1M, 2M, 4M urea)
      c. Measure remaining activity or structural integrity at 0h, 1h, 4h, 24h, 72h, 168h
      d. Analyze using repeated measures ANOVA or mixed-effects models

This approach is statistically more powerful than between-subjects designs and specifically addresses the research question of how different environmental conditions affect MJ0545 stability over time .

What research questions can be formulated to guide investigation of MJ0545 function?

Formulating clear, testable research questions is crucial for systematic investigation of uncharacterized proteins like MJ0545. The following questions adhere to best practices for research question development :

  • Structure-function relationship questions:

    • How do specific structural domains of MJ0545 contribute to its thermostability?

    • What specific amino acid residues are essential for MJ0545 function?

    • How does the three-dimensional structure of MJ0545 compare to characterized proteins with similar domains?

  • Biochemical characterization questions:

    • What substrates, if any, can MJ0545 bind or process?

    • What cofactors are required for MJ0545 activity?

    • How do extreme temperature and pressure conditions affect MJ0545 catalytic activity?

  • Evolutionary biology questions:

    • How conserved is MJ0545 across archaeal species?

    • What evidence exists for horizontal gene transfer of MJ0545 or its homologs?

    • How has the function of MJ0545 homologs evolved across different environmental niches?

  • Cellular role questions:

    • In which cellular compartment or membrane is MJ0545 located?

    • What cellular processes are affected by MJ0545 deletion or overexpression?

    • How is MJ0545 expression regulated under different environmental conditions?

These research questions follow the criteria for effective scientific inquiry by being clear, concise, and open-ended, while focusing on specific aspects of MJ0545 that can be investigated through experimental approaches . Each question is narrow enough to be addressed with specific methodologies but broad enough to contribute to our understanding of this uncharacterized protein.

How can adaptive intervention trials be designed to optimize expression and purification protocols for MJ0545?

Adaptive intervention trials, traditionally used in clinical research, can be effectively applied to optimize protein expression and purification protocols for challenging proteins like MJ0545:

  • Sequential multiple assignment randomized trial (SMART) approach:

    • Allows for systematic adaptation of protocols based on interim results

    • Provides a framework for decision rules that specify when and how to modify protocols

    • Optimizes long-term outcomes rather than immediate results

  • Implementation for MJ0545 expression optimization:

    a. Stage 1: Initial expression screening

    • Random assignment to different expression vectors and host strains

    • Evaluation of initial expression levels

    • Decision rule: Proceed with high expressers; modify conditions for low expressers

    b. Stage 2: Induction and growth optimization

    • For high expressers: randomize to different induction conditions

    • For low expressers: randomize to different media formulations and chaperone co-expression

    • Evaluate protein solubility and yield

    c. Stage 3: Purification optimization

    • Tailored purification strategies based on previous outcomes

    • Decision rules for additional purification steps based on purity assessment

  • Advantages of this approach:

    • More efficient use of resources compared to traditional factorial designs

    • Allows for personalized optimization pathways for difficult proteins

    • Provides insights into which factors are most critical at each stage

    • Generates data to inform decision rules for future optimization efforts

  • Analysis methods:

    • Compare the effectiveness of different adaptive intervention strategies

    • Identify critical decision points that most impact final protein quality

    • Use statistical models that account for the sequential nature of the design

This adaptive approach is particularly valuable for archaeal proteins like MJ0545, which may require non-standard expression and purification conditions due to their unique properties and thermostable nature .

What are the most promising approaches for definitively characterizing the function of MJ0545?

Based on current methodologies and the information available about MJ0545, the most promising approaches for functional characterization include:

  • Integrated structural genomics pipeline:

    • High-resolution structure determination (X-ray crystallography or cryo-EM)

    • Structure-based function prediction

    • In silico ligand screening and docking

    • Validation of predictions through biochemical assays

  • Systems biology approach:

    • Genome-wide association studies within archaeal systems

    • Metabolomic profiling in knockout or overexpression strains

    • Network analysis to position MJ0545 within cellular pathways

    • Comparative genomics across extremophilic archaea

  • Advanced genetic tools:

    • CRISPR-Cas9 gene editing in M. jannaschii or related model archaea

    • Complementation studies in knockout strains

    • Synthetic biology approaches to reconstruct minimal systems

These integrated approaches, combined with the methodologies discussed throughout this FAQ, provide the most promising path toward definitively characterizing the function of MJ0545 and understanding its role in archaeal biology .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.