Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0611.1 (MJ0611.1)

Shipped with Ice Packs
In Stock

Description

Recombinant Production

MJ0611.1 is commercially available as a recombinant protein for biochemical studies. Production protocols involve:

  • Cloning: The mj0611.1 gene is ligated into expression vectors (e.g., pT7-7) and transformed into E. coli .

  • Purification: Affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resins to isolate His-tagged protein .

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C to preserve stability .

Functional Insights

  • Genomic Context: The mj0611.1 gene resides on plasmid pDSM2661_1, which harbors 54 protein-coding genes of largely unknown function .

  • Homology: No significant sequence similarity to proteins in other archaea or bacteria, limiting functional predictions .

  • Genetic Tools: Recent development of M. jannaschii genetic systems enables targeted gene deletion or tagging for functional studies .

Research Applications

MJ0611.1 is primarily used in:

  1. Structural Genomics: As part of efforts to characterize unannotated archaeal proteins .

  2. Enzyme Engineering: Testing thermostability in synthetic biology workflows .

  3. Antibody Production: Serving as an antigen for custom antibody generation .

Challenges and Future Directions

The lack of functional annotation highlights gaps in archaeal proteomics. Key priorities include:

  • In vitro Activity Screens: Testing for enzymatic activity using substrates like ATP, NADH, or coenzyme F420 .

  • Interaction Studies: Identifying binding partners via pull-down assays or yeast two-hybrid systems .

  • Crystallography: Solving its 3D structure to infer mechanistic roles .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0611.1; Uncharacterized protein MJ0611.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0611.1
Target Protein Sequence
MESIYLGNCWTPFNWIYAIYDVLVKILSIREIFQILSLMYLLFLYIGFLLISKFDISLSL AFFFPCVFWICWAKIKNETWDIPNRKNRLVPLIFTLIYLSILAIFWKNIFIIIFLVNVLV ILIITKFWKISMHNYGLSAMAYLIYAFTNSIWLSTIYLILVIITGYARIYLKKHTVSQVI AGTILGISVNYILLNLI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Methanocaldococcus jannaschii and why is it significant for studying uncharacterized proteins like MJ0611.1?

Methanocaldococcus jannaschii (formerly known as Methanococcus jannaschii) is a hyperthermophilic methanogenic archaeon isolated from a submarine hydrothermal vent at the East Pacific Rise at a depth of 2600m . It represents an extremophile capable of growing at temperatures ranging from 48-94°C, pressures exceeding 200 atm, and moderate salinity .

Its significance stems from several key factors:

  • It was the first archaeon to have its complete genome sequenced in 1996, revealing many genes unique to the archaeal domain

  • Its genome consists of a 1.66 Mbp circular chromosome with a G+C content of 31.4%

  • It serves as a model organism for studying archaeal biology, hyperthermophilic adaptations, and evolutionary relationships

  • The MjCyc pathway-genome database has identified 652 function assignments with enzyme roles, but approximately one-third of the genome, including MJ0611.1, remains functionally uncharacterized

Studying uncharacterized proteins like MJ0611.1 provides opportunities to discover novel enzymatic activities, protein structures, and metabolic pathways that may be unique to archaea or organisms adapted to extreme environments.

What are the general characteristics of protein MJ0611.1 based on current annotations?

MJ0611.1 is currently annotated as an uncharacterized protein in Methanocaldococcus jannaschii. Based on available information:

  • It is a full-length protein consisting of 197 amino acids

  • It is available as a recombinant protein with His-tag modifications for research purposes

  • Its function remains unknown, placing it among the approximately one-third of M. jannaschii proteins classified as "microbial dark matter"

Computational analysis suggests the following characteristics, though these require experimental validation:

PropertyPredicted ValueMethod
Molecular Weight~22 kDa (estimated)Based on amino acid length
Expression SystemE. coliCommonly used for recombinant production
Protein FamilyUnknownNo clear homology to characterized proteins
Conserved DomainsNone identifiedBased on current annotation

What methods are recommended for the expression and purification of recombinant MJ0611.1?

When working with recombinant MJ0611.1 or similar uncharacterized proteins from M. jannaschii, consider the following methodological approach:

Expression System Selection:

  • E. coli is the most commonly used expression system for M. jannaschii proteins

  • For challenging proteins, consider using specialized E. coli strains designed for hyperthermophilic proteins or alternative systems like yeast or baculovirus

Expression Protocol:

  • Clone the MJ0611.1 gene into an expression vector containing a His-tag (typically N-terminal or C-terminal)

  • Transform into an E. coli expression strain (BL21(DE3), Rosetta, or Arctic Express for problematic expression)

  • Culture at 37°C until reaching OD600 0.5-0.7

  • Induce with IPTG (0.1-1.0 mM) at reduced temperature (16-30°C) for 4-18 hours

  • Harvest cells by centrifugation

Purification Strategy:

  • Lyse cells under native conditions (for soluble protein) or denaturing conditions (for inclusion bodies)

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Consider heat treatment (60-80°C) as a purification step, leveraging the thermostability of M. jannaschii proteins

  • Apply size exclusion chromatography as a polishing step

  • Verify purity using SDS-PAGE and Western blotting

Storage recommendations include maintaining the protein in buffer containing glycerol at -20°C for short-term or -80°C for long-term storage .

What computational approaches can be used to predict the function of uncharacterized proteins like MJ0611.1?

Predicting functions of uncharacterized archaeal proteins like MJ0611.1 requires sophisticated computational approaches:

Homology-Based Methods:

  • PSI-BLAST and HHpred for remote homology detection beyond standard BLAST

  • Fold recognition methods that can identify structural similarities despite low sequence identity

  • Metagenomic mining to identify similar sequences in environmental samples from hydrothermal vents

Contextual Information Analysis:

  • Genomic context examination, as genes in close proximity may have related functions

  • Analysis of the MjCyc metabolic reconstruction to identify potential pathway gaps that MJ0611.1 might fill

  • Co-expression pattern analysis across different growth conditions

Structural Prediction Approaches:

  • AlphaFold2 or RoseTTAFold for ab initio structure prediction

  • Analysis of predicted binding pockets for potential substrates

  • Molecular docking simulations with potential ligands from M. jannaschii metabolism

Recent successful applications include the identification of MJ1598 as EC 2.4.2.21 (nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase) and MJ0570 as EC 6.3.1.14 (diphthamide synthase) using similar approaches .

How can genetic manipulation systems for M. jannaschii be used to study MJ0611.1 in vivo?

The genetic system for M. jannaschii developed by Das et al. (2019) provides powerful tools for studying uncharacterized proteins like MJ0611.1 in vivo :

Gene Knockout Approach:

  • Design a suicide vector containing upstream and downstream regions of the MJ0611.1 gene (similar to pDS200)

  • Include a selectable marker (e.g., mevinolin resistance gene)

  • Transform linearized vector into M. jannaschii cells using heat shock method

  • Select transformants on solid medium containing mevinolin

  • Verify gene deletion by PCR and phenotypic analysis

Protein Tagging Strategy:

  • Construct a vector containing:

    • Homologous regions for targeted integration

    • Coding sequence for 3xFLAG-twin Strep tag

    • Strong promoter (e.g., modified P* promoter)

  • Transform linearized vector into M. jannaschii

  • Select transformants and verify by PCR

  • Grow the strain and isolate the tagged protein using affinity purification

Transformation Protocol Optimization:
The transformation efficiency reported for M. jannaschii is approximately 10⁴ colonies per μg of DNA . Key steps include:

  • Grow cells at 65°C to OD600 of 0.5-0.7

  • Harvest cells by centrifugation under anaerobic conditions

  • Resuspend in pre-reduced medium

  • Incubate with linearized DNA at 4°C

  • Apply heat shock at 85°C for 45 seconds

  • Recover and select on appropriate medium

This genetic system is significantly faster than those for other methanogens, with colonies forming in 3-4 days compared to 7-14 days for Methanococcus maripaludis and Methanosarcina species .

What analytical techniques are most effective for characterizing the structure and function of hyperthermophilic archaeal proteins like MJ0611.1?

Characterizing hyperthermophilic archaeal proteins requires specialized techniques that account for their unique properties:

Structural Analysis:

  • X-ray crystallography at different temperatures (20-80°C) to observe temperature-dependent conformational changes

  • Cryo-electron microscopy for larger protein complexes

  • Circular dichroism spectroscopy to assess secondary structure stability across temperature ranges

  • NMR spectroscopy for dynamic analysis of protein structure

Functional Characterization:

  • Activity assays at elevated temperatures (65-85°C) under anaerobic conditions

  • Metabolomic analysis to identify potential substrates:

    • LC-MS/MS profiling of M. jannaschii metabolites

    • In vitro substrate screening using metabolite libraries

  • Protein-protein interaction studies:

    • Pull-down assays using the tagged version of MJ0611.1

    • Crosslinking mass spectrometry at high temperatures

  • Spectroscopic methods for detecting cofactor binding

Thermal Stability Assessment:

  • Differential scanning calorimetry to determine melting temperatures

  • Thermofluor assays for high-throughput stability screening with different buffers

  • Limited proteolysis under various temperature conditions

The analysis of Mj-FprA (MJ_0748) using affinity purification followed by thermolysin digestion and mass spectrometry provides a successful case study for this approach .

How does the extreme environment of M. jannaschii influence protein structure and function, and what implications does this have for studying MJ0611.1?

The extreme conditions of M. jannaschii's habitat have profound effects on protein structure and function that must be considered when studying MJ0611.1:

Structural Adaptations to Extreme Conditions:

Environmental FactorProtein AdaptationImplication for MJ0611.1 Research
High Temperature (85°C)Increased hydrophobic core packingMay require thermostable buffers for activity assays
Higher proportion of charged residuesCould have unusual pH optima
Disulfide bonds and salt bridgesMay lose activity upon reduction
High Pressure (>200 atm)Compact structure with minimal cavitiesCould require pressure for proper folding
Pressure-sensitive active sitesMay show different kinetics at atmospheric pressure
Anaerobic EnvironmentOxygen-sensitive domainsHandle under strict anaerobic conditions
Unique metal coordinationMay require specific metals for activity

Methodological Considerations:

  • Activity assays should be performed at physiologically relevant temperatures (75-85°C)

  • Consider using specialized high-pressure equipment for enzyme kinetics

  • Maintain anaerobic conditions throughout purification and analysis

  • Include thermostable buffers and reducing agents in storage solutions

Evolutionary Implications:

  • MJ0611.1 may represent an ancient protein family predating the divergence of Bacteria and Archaea

  • Function prediction should consider the metabolic requirements of organisms in hydrothermal vent ecosystems

  • Thermal adaptation may mask sequence similarity to mesophilic homologs

Research on M. jannaschii proteins has revealed novel enzymatic mechanisms adapted to extreme conditions, as demonstrated by studies on its methanogenesis pathways and unique coenzyme F420-dependent enzymes .

What comparative genomics approaches can help elucidate the role of MJ0611.1?

Comparative genomics offers powerful strategies for understanding the potential function of MJ0611.1:

Phylogenetic Profiling:

  • Map the presence/absence pattern of MJ0611.1 homologs across archaeal species

  • Correlate these patterns with metabolic capabilities or environmental niches

  • Identify co-occurring genes that may function in the same pathway

Synteny Analysis:

  • Examine gene neighborhood conservation across related genomes

  • Identify operonic structures that may suggest functional relationships

  • Compare with syntenic regions in other methanogens and thermophiles

Sequence-Structure-Function Relationships:

  • Identify distant homologs using position-specific scoring matrices

  • Map conserved residues onto predicted structural models

  • Compare with characterized proteins from related organisms

Metabolic Context Analysis:
Using the MjCyc metabolic reconstruction , examine:

  • Pathway gaps that could be filled by MJ0611.1

  • Reactions requiring thermophilic-specific enzymes

  • Unique metabolic features of M. jannaschii compared to other methanogens

A practical example of this approach is the identification of MJ0879 as a subunit of Ni-sirohydrochlorin a,c-diamide reductive cyclase (EC 6.3.3.7), which was previously misidentified as a nitrogenase iron protein based solely on protein family motifs .

What are the challenges and solutions for crystallizing recombinant M. jannaschii proteins like MJ0611.1?

Crystallizing hyperthermophilic archaeal proteins presents unique challenges:

Common Challenges:

  • Conformational flexibility at room temperature

  • Unusual amino acid composition affecting crystal contacts

  • Requirement for anaerobic conditions

  • Need for specific cofactors or ligands for stabilization

  • Potential for oxidation during crystallization

Optimized Crystallization Strategy:

PhaseMethodologySpecial Considerations
Protein PreparationHigh-purity preparation (>95%)Include reducing agents to prevent oxidation
Test multiple constructs with different tagsConsider tag position impact on folding
Assess protein quality by DLS/SECEnsure monodispersity at high temperatures
Crystallization ConditionsScreen at multiple temperatures (4-60°C)Higher temperatures may better mimic native conditions
Include stabilizing additivesTest archaeal-specific cofactors
Set up under anaerobic conditionsUse specialized anaerobic crystallization chambers
Crystal HandlingCryoprotection optimizationTest archaeal-compatible cryoprotectants
Flash-cooling protocolsConsider room-temperature data collection
Structure DeterminationHeavy atom derivativesTest multiple derivatives for phasing
Molecular replacementUse thermophilic homologs as search models

Successful Case Studies:
Several M. jannaschii proteins have been successfully crystallized using similar approaches, including:

  • Various methanogenesis enzymes

  • DNA and RNA processing proteins

  • Proteomic studies have identified 19 inteins in M. jannaschii that must be considered when designing constructs for crystallization

How can tRNA modification studies in M. jannaschii inform research on protein translation affecting recombinant MJ0611.1 expression?

Recent research on tRNA modifications in M. jannaschii provides valuable insights for optimizing recombinant protein expression:

Key Findings from M. jannaschii tRNA Studies:

  • A comprehensive characterization of 34 out of 35 unique tRNA sequences has been completed

  • A novel modified nucleoside, 5-cyanomethyl-2-thiouridine (cnm5s2U), was discovered at position 34

  • M. jannaschii follows codon-decoding strategies similar to bacteria, but with more extensive modifications at position 37

Implications for Recombinant Expression:

tRNA Modification FeatureImpact on ExpressionOptimization Strategy
Position 34 modificationsAffects codon-anticodon recognitionCodon optimization for E. coli expression
Wyosine pathway modificationsInfluences translation accuracyConsider specialized expression strains
Archaeal-specific modificationsMay cause translational pausing in bacteriaSupplement rare tRNAs in expression host

Methodological Approaches:

  • Codon optimization strategy:

    • Analyze codon usage in M. jannaschii

    • Identify rare codons in the MJ0611.1 sequence

    • Optimize for expression host while preserving critical codons at structurally important sites

  • Expression host selection:

    • Consider Rosetta strains providing rare tRNAs

    • Test archaeal expression systems for difficult proteins

  • Translation rate modulation:

    • Lower induction temperature to reduce translation rate

    • Use weaker promoters to improve folding efficiency

Understanding these tRNA modification patterns is particularly relevant when expressing hyperthermophilic proteins in mesophilic hosts, as differences in translation dynamics can significantly impact protein folding and activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.