Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0645 (MJ0645)

Shipped with Ice Packs
In Stock

Description

Potential Metabolic Pathways

M. jannaschii is a model organism for studying hyperthermophilic metabolism, including methanogenesis, cofactor biosynthesis, and RNA/DNA processing . While MJ0645’s function is unknown, its homology to other archaeal proteins could imply involvement in:

  • Cofactor biosynthesis: Methanogens require unique cofactors (e.g., F420, H4MPT) for methanogenesis .

  • Protein secretion or folding: M. jannaschii has novel pathways for protein maturation under extreme conditions .

  • Stress response: Hyperthermophiles employ specialized chaperones or proteases for protein stability .

Applications in Research

MJ0645 serves as a tool for:

  1. Structural studies: X-ray crystallography or cryo-EM to elucidate its 3D structure.

  2. Functional screening: High-throughput assays to test interactions with substrates/cofactors.

  3. Comparative genomics: Phylogenetic analysis to identify conserved motifs across archaea.

Limitations and Future Directions

  • Functional ambiguity: No published studies link MJ0645 to specific biochemical pathways.

  • Methodological challenges: M. jannaschii’s hyperthermophilic nature complicates in vivo assays.

Future research should prioritize:

  • Co-expression with interacting partners to identify functional complexes.

  • Knockout studies in M. jannaschii to assess phenotypic effects.

  • Bioinformatics: Predictive modeling of substrate binding sites or catalytic residues.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in sterile, deionized water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
MJ0645; Uncharacterized protein MJ0645
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0645
Target Protein Sequence
MLRIPRSLKSIINTINGESGTRYIVRGLIDGSLSALGVVIGASGSADASVIIAAGLGGGI ANGLSNILGAFTAEKASLERERIQKEKSLLKKNGYLKKSIIYKKAIRETMICGLIDGIST TIGSALPVVPFFLFDIKTALYVAIGITIAILFILGVFIGKISKENVIISGIKMVAGALAV AILCFMIEKAF
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0645

STRING: 243232.MJ_0645

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should researchers properly reconstitute and store recombinant MJ0645 protein?

For optimal results when working with recombinant MJ0645 protein, follow these methodological guidelines:

  • Centrifuge the vial briefly before opening to bring contents to the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot the solution for long-term storage at -20°C/-80°C to prevent degradation

Avoid repeated freeze-thaw cycles as they significantly reduce protein activity. For working aliquots, store at 4°C for up to one week . The protein is typically provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during the lyophilization process.

What expression systems are suitable for producing recombinant MJ0645?

  • Codon optimization: Archaeal coding sequences often contain rare codons for E. coli, requiring codon optimization or special E. coli strains

  • Protein folding: Thermophilic proteins may not fold properly at standard E. coli growth temperatures (37°C)

  • Purification strategy: The N-terminal His-tag enables purification via nickel affinity chromatography

  • Solubility considerations: Membrane-associated archaeal proteins may require detergents or specialized buffers

For functional studies, expression of MJ0645 in archaeal hosts like Methanococcus maripaludis or Thermococcus kodakarensis might provide better native folding, though these systems are technically more challenging than E. coli expression.

How can researchers verify the purity and integrity of recombinant MJ0645?

Standard analytical procedures for quality control of recombinant MJ0645 include:

Analytical MethodPurposeTypical Results
SDS-PAGEProtein purity assessment>90% purity; single band at ~21-23 kDa (including His-tag)
Western blotSpecific identificationPositive signal with anti-His antibodies
Mass spectrometryAccurate mass determinationMatch to theoretical mass (plus modifications)
Circular dichroismSecondary structure assessmentPattern consistent with predicted structure
Dynamic light scatteringAggregation assessmentMonodisperse preparation indicates proper folding

Researchers should always include these verifications in their experimental protocols, as protein quality directly impacts downstream applications and experimental reproducibility.

What approaches are recommended for functional characterization of uncharacterized proteins like MJ0645?

Comprehensive functional characterization of uncharacterized proteins like MJ0645 requires a multi-faceted approach:

  • Bioinformatic analysis:

    • Homology modeling using structural prediction algorithms

    • Identification of conserved domains across related species

    • Protein family classification

  • Protein-protein interaction studies:

    • Crosslinking mass spectrometry to capture transient interactions

    • Cofractionation mass spectrometry (CoFrac-MS) with size exclusion chromatography

    • Comparison between crosslinked and untreated samples to identify stable vs. transient interactions

  • Biochemical characterization:

    • Substrate binding assays

    • Enzymatic activity screens with potential substrates

    • Thermal stability analysis relevant to the thermophilic nature of M. jannaschii

The combination of crosslinking with cofractionation has proven particularly valuable for identifying interactions involving uncharacterized proteins. Studies have shown that of 39 protein-protein interactions involving uncharacterized proteins identified by crosslinking MS, 28 could be compared between crosslinked and untreated conditions, demonstrating the importance of stabilizing protein complexes prior to analysis .

How can researchers investigate MJ0645's potential membrane association given its sequence characteristics?

Based on sequence analysis suggesting potential membrane domains, researchers should consider these methodological approaches:

  • Membrane incorporation studies:

    • Liposome reconstitution experiments

    • Detergent solubility profiling

    • Fluorescence-based membrane insertion assays

  • Localization studies:

    • Subcellular fractionation of archaeal cells

    • Immunolocalization with anti-MJ0645 antibodies

    • Fusion with fluorescent proteins in model archaeal systems

  • Topological analysis:

    • Protease accessibility assays

    • Chemical labeling of exposed residues

    • Cysteine-scanning mutagenesis

When designing these experiments, researchers should account for the extreme conditions under which M. jannaschii naturally exists (48-94°C, high pressure, moderate salinity) , as these may influence protein-membrane interactions and native conformation.

What structural analysis techniques are most suitable for determining MJ0645's three-dimensional structure?

For structural determination of MJ0645, researchers should consider:

TechniqueAdvantagesLimitationsSample Requirements
X-ray crystallographyHigh-resolution (potentially <2Å)Requires crystallization5-10 mg highly pure protein
Cryo-electron microscopyNo crystallization neededLower resolution for small proteins50-100 μg pure protein
NMR spectroscopySolution-state dynamicsSize limitations (~30 kDa)15N/13C-labeled protein (2-5 mg)
AI-assisted structural predictionNo experimental sample neededRequires validationAmino acid sequence only

Recent advances in AI-assisted structural proteomics have demonstrated success in modeling protein complexes and can be particularly valuable for initially understanding uncharacterized proteins . For MJ0645, a combined approach using AlphaFold2 prediction followed by experimental validation via one or more of these techniques would provide the most robust structural insights.

How can researchers investigate potential interacting partners of MJ0645 in vivo?

To identify physiologically relevant protein-protein interactions for MJ0645:

  • In-cell crosslinking approaches:

    • Chemical crosslinking prior to cell lysis preserves transient interactions

    • Analysis by mass spectrometry after affinity purification

    • Comparison between crosslinked and non-crosslinked samples to identify stabilized interactions

  • Cofractionation strategies:

    • Size exclusion chromatography of soluble proteomes

    • Collection of multiple fractions (e.g., 50 fractions)

    • Quantitative LC-MS analysis of each fraction

    • Computation of co-elution scores using tools like PCprophet

Research has shown that for protein-protein interactions involving uncharacterized proteins, approximately two-thirds displayed higher co-elution scores following in-cell crosslinking, demonstrating the value of stabilizing the proteome prior to cell lysis . A study examining 28 protein-protein interactions involving uncharacterized proteins found that 10 showed no co-elution or were difficult to classify, 10 co-eluted in both conditions, and 8 co-eluted only after crosslinking .

What approaches should be used to investigate MJ0645's potential role in M. jannaschii's adaptation to extreme environments?

As M. jannaschii is a thermophilic archaeon adapted to high temperatures (48-94°C), high pressure, and moderate salinity environments , researchers investigating MJ0645's potential role in these adaptations should consider:

  • Thermal stability analysis:

    • Differential scanning calorimetry

    • Circular dichroism spectroscopy at varying temperatures

    • Activity assays across temperature ranges

  • Pressure adaptation studies:

    • High-pressure biophysical measurements

    • Comparison of structure/function at atmospheric vs. high pressure

    • Molecular dynamics simulations incorporating pressure effects

  • Comparative genomics:

    • Identification of homologs in other extremophiles

    • Analysis of conservation in thermophilic vs. mesophilic archaea

    • Evolutionary rate analysis to identify selection signatures

  • Gene knockout/complementation:

    • CRISPR-Cas9 editing in model archaeal systems

    • Phenotypic analysis under varying environmental conditions

    • Complementation studies with wild-type vs. mutant forms

How should researchers design controls when studying an uncharacterized protein like MJ0645?

Proper experimental design for MJ0645 research requires these control strategies:

  • Negative controls:

    • Empty vector controls for expression studies

    • Tag-only proteins for interaction studies

    • Buffer-only conditions for binding assays

  • Positive controls:

    • Well-characterized proteins from the same organism

    • Known interacting partners for related proteins

    • Thermostable control proteins for stability assays

  • Technical validation:

    • Biological replicates (minimum n=3)

    • Multiple methodological approaches for key findings

    • Concentration gradients for binding/activity studies

When designing a crosslinking mass spectrometry experiment to identify MJ0645 interactions, researchers should include both untreated samples and samples with non-specific crosslinkers to distinguish specific from non-specific interactions .

What statistical approaches are recommended for analyzing protein-protein interaction data involving MJ0645?

For robust statistical analysis of protein-protein interaction data:

  • For cofractionation MS data:

    • Calculate co-elution scores using specialized software (e.g., PCprophet)

    • Apply false discovery rate (FDR) control

    • Use hierarchical clustering to identify protein complexes

    • Compare crosslinked vs. non-crosslinked samples quantitatively

  • For crosslinking MS data:

    • Apply scoring algorithms specific to crosslinked peptides

    • Use distance constraints for structural validation

    • Perform enrichment analysis for functional categories

    • Visualize interaction networks using appropriate software

  • Data integration approaches:

    • Bayesian integration of multiple data types

    • Machine learning classification of true vs. false interactions

    • Network analysis incorporating prior knowledge

The combination of multiple orthogonal techniques provides the strongest evidence for true interactions, with studies showing that approximately 66% of protein-protein interactions display higher co-elution scores following in-cell crosslinking stabilization .

How can researchers accurately document and report experimental data for MJ0645 studies?

For comprehensive and reproducible documentation:

  • Raw data reporting:

    • Include all experimental parameters in methods sections

    • Deposit mass spectrometry raw files in public repositories

    • Share complete datasets even when results are negative

  • Data table construction:

    • Title tables descriptively based on the data contained

    • Include appropriate columns for manipulated and responding variables

    • Record data with consistent precision (decimal places)

    • Include measurement uncertainty where appropriate

  • Sample data table format:

Sample ConditionTrial 1 MJ0645 Activity (units)Trial 2 MJ0645 Activity (units)Trial 3 MJ0645 Activity (units)Average Activity ± SD (units)
25°C0.250.280.230.25 ± 0.03
50°C1.231.181.251.22 ± 0.04
75°C2.562.622.592.59 ± 0.03
90°C1.751.711.781.75 ± 0.04

Data tables should be self-contained with clear labeling and should not break across multiple pages . Each cell should contain a value, and numerical precision should be consistent throughout.

What are common challenges in expressing and purifying MJ0645, and how can they be addressed?

Researchers frequently encounter these challenges when working with MJ0645:

  • Low expression yields:

    • Optimize codon usage for expression host

    • Test multiple expression strains (BL21, Rosetta, etc.)

    • Vary induction conditions (temperature, IPTG concentration)

    • Consider autoinduction media for gradual protein production

  • Protein insolubility:

    • Express at lower temperatures (16-20°C)

    • Include solubility enhancers (e.g., sorbitol, glycerol)

    • Test fusion partners (SUMO, MBP, GST)

    • Consider mild detergents for membrane-associated proteins

  • Poor affinity purification:

    • Optimize imidazole concentrations in binding/wash/elution buffers

    • Test different metal ions (Ni2+, Co2+, Cu2+) for His-tag binding

    • Include reducing agents to prevent disulfide formation

    • Consider on-column refolding protocols

  • Protein instability:

    • Add stabilizing agents (glycerol, trehalose)

    • Maintain reducing conditions

    • Test different buffer systems and pH values

    • Store in small aliquots to avoid freeze-thaw cycles

How can researchers overcome the challenges of studying protein-protein interactions in thermophilic organisms?

When investigating interactions involving thermophilic proteins like MJ0645:

  • Temperature considerations:

    • Perform binding assays at physiologically relevant temperatures

    • Ensure equipment can maintain stable high temperatures

    • Consider temperature effects on crosslinking chemistry

    • Use thermostable reagents for all steps

  • Stabilization strategies:

    • Apply in vivo crosslinking before cell lysis to preserve interactions

    • Compare crosslinked and non-crosslinked samples to identify stabilized interactions

    • Use specialized buffers mimicking cytoplasmic conditions of thermophiles

  • Technical adaptations:

    • Modify standard protocols for high-temperature compatibility

    • Increase crosslinking reaction times for better efficiency

    • Consider native vs. denaturing conditions carefully

    • Use thermostable affinity tags for purification

Research has demonstrated that in-cell crosslinking significantly improves detection of protein-protein interactions involving uncharacterized proteins, with approximately two-thirds of interactions showing improved co-elution profiles after crosslinking .

What approaches can resolve contradictory functional predictions for MJ0645?

When faced with conflicting functional predictions for uncharacterized proteins:

  • Hierarchical testing approach:

    • Begin with broad functional categories

    • Design experiments to systematically eliminate possibilities

    • Develop decision trees for subsequent experiments

    • Integrate results from multiple approaches

  • Comparative analysis:

    • Test predictions across multiple homologs

    • Consider evolutionary conservation patterns

    • Examine genomic context across related species

    • Analyze gene neighborhood for functional clues

  • Domain-specific investigations:

    • Express and test individual domains separately

    • Create chimeric proteins to test domain functions

    • Perform targeted mutagenesis of predicted active sites

    • Use truncation series to identify functional regions

  • Integrative approaches:

    • Combine computational predictions with experimental validation

    • Weight evidence based on methodological strength

    • Consider consensus across multiple prediction algorithms

    • Develop quantitative scoring for competing hypotheses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.