Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0696 (MJ0696)

Shipped with Ice Packs
In Stock

Description

General Information about MJ0696

MJ0696 is one of the many open reading frames (ORFs) identified in the M. jannaschii genome . It is categorized among those ORFs that initially did not show any homology to known sequences in M. jannaschii or other organisms . The function of MJ0696 remains unknown, highlighting a gap in the understanding of the organism's complete biological processes .

Genomic Context

The genome of M. jannaschii is approximately 1.66 million base pairs long . The sequence data obtained from the genome sequencing project is highly accurate and has been instrumental in identifying various ORFs, including MJ0696 . The position of MJ0696 within the genome can be found using the sequence identifiers (SEQ ID NO) provided in the complete genome sequence .

Research and Studies Involving M. jannaschii

Genetic tools and methods have been developed to manipulate the genes of M. jannaschii, including the ability to knock out or modify genes and genetically fuse genes with affinity tag sequences . These advancements facilitate the isolation of proteins with M. jannaschii-specific attributes, aiding in the study of uncharacterized proteins like MJ0696 .

Potential Research Directions

  1. Expression Analysis: Investigating the conditions under which MJ0696 is expressed could provide clues about its function. This can be achieved through transcriptomic studies, which analyze the messenger RNA (mRNA) levels of the mj0696 gene under different environmental conditions .

  2. Protein Interaction Studies: Identifying proteins that interact with MJ0696 can help elucidate its role in cellular processes. Techniques such as co-immunoprecipitation followed by mass spectrometry can be employed to identify these interacting proteins .

  3. Structural Analysis: Determining the three-dimensional structure of MJ0696 may provide insights into its function. X-ray crystallography or nuclear magnetic resonance (NMR) spectroscopy can be used for this purpose .

  4. Homology Modeling: Comparing the amino acid sequence of MJ0696 with those of proteins with known functions in other organisms may reveal potential functions based on structural similarities .

Tables of Relevant Data

Because there is no specific research available regarding the function of the uncharacterized protein MJ0696, the tables below contain data regarding general M. jannaschii information.

Table 1: General Information of Methanocaldococcus jannaschii

FeatureDescription
OrganismMethanocaldococcus jannaschii
Genome SizeApproximately 1.66 million base pairs
HabitatDeep-sea hydrothermal vents
Energy SourceHydrogenotrophic methanogenesis (4H2 + CO2 -> CH4 + 2H2O)
Unique FeatureFirst archaeon to have its complete genome sequenced
SignificanceModel organism for studying archaeal biology, methanogenesis, and adaptation to extreme environments

Table 2: Genomic Features of Methanocaldococcus jannaschii

FeatureDescription
Open Reading FramesApproximately 1,700 ORFs
Uncharacterized GenesApproximately 60% of the genes have no assigned function
Redox Control SystemsAncient redox control systems
InteinsAbsent in Methanocaldococcus jannaschii, even though close homologs of most intein-containing proteins are present, contrasting with the related organism Methanocaldococcus jannaschii
Homologs of FprAMj_0732 and Mj_0748 are homologs of FprA

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
MJ0696; Uncharacterized protein MJ0696
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0696
Target Protein Sequence
MESILFIAIAFLINSFISYKITNMQPKIKSRIFKRVKMHYLNLIEGKKAEFDKKAMPILF GFMIIALISFNILLYVVYNCPVSITSIIAEILIIISMIIIWKAFNKEISVYLCDDGIYYS NKFISWKNIENVKKDDGFIVLFGKKKKILGRKLYLLQRIYLKYDEEIENIIKNQIEKFRD KA
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0696

STRING: 243232.MJ_0696

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal growth conditions for culturing Methanocaldococcus jannaschii to express MJ0696?

Methanocaldococcus jannaschii requires specific hyperthermophilic and anaerobic conditions for optimal growth and protein expression. The organism grows best at 80°C in a medium containing H₂ and CO₂ (80:20, v/v) as methanogenesis substrates . For liquid culture, use sealed serum bottles with anaerobic medium pressurized with H₂ and CO₂ mixture to 3 × 10⁵ Pa . Incubation should occur in a shaker incubator at 80°C and 200 rpm . Growth can be monitored by measuring optical density at 600 nm, with optimal harvesting typically occurring at OD₆₀₀ values of 0.5-0.7, which corresponds to approximately 2-4 × 10⁸ cells/ml . This careful attention to growth parameters ensures sufficient biomass for downstream protein isolation and characterization.

How can I design primers for amplifying the MJ0696 gene from Methanocaldococcus jannaschii?

When designing primers for amplifying the MJ0696 gene, consider the following methodological approach:

  • Identify the complete gene sequence for MJ0696 from the M. jannaschii genome database

  • Design primers with the following characteristics:

    • 18-25 nucleotides in length

    • 40-60% GC content

    • Melting temperature (Tm) between 55-65°C

    • Include restriction enzyme sites at the 5' ends for downstream cloning

    • Add 3-6 additional nucleotides at the 5' end of restriction sites to facilitate enzyme cutting

When designing PCR protocols, account for the high GC content typical of extremophile genomes by including DMSO (5-10%) or betaine (1-2M) to prevent secondary structure formation during amplification. Validate your primer design using primer analysis software to check for self-complementarity, hairpin formation, or potential off-target binding sites before synthesis.

What are the predicted structural features of MJ0696 based on bioinformatic analysis?

While specific structural data for MJ0696 is limited, bioinformatic approaches can provide valuable predictions. Begin with sequence analysis using tools like BLAST to identify homologs and potential functional domains. Secondary structure prediction algorithms typically suggest patterns of α-helices, β-sheets, and random coils. Given the hyperthermophilic nature of M. jannaschii, the protein likely contains features that contribute to thermostability, such as:

  • Higher proportion of charged amino acids

  • Increased number of salt bridges

  • More compact hydrophobic core

  • Reduced number of thermolabile residues

Tertiary structure can be predicted using homology modeling if sufficient homologs exist, or ab initio modeling approaches. Molecular dynamics simulations at elevated temperatures (80°C) may provide insights into thermostability mechanisms. These predictions should be treated as hypotheses to be verified through experimental structural determination methods like X-ray crystallography or NMR spectroscopy.

What expression systems are most effective for recombinant production of MJ0696?

The optimal expression system for MJ0696 depends on your experimental goals. Consider these methodological approaches:

Expression SystemAdvantagesChallengesRecommended Use Cases
E. coli (pET series)High yield, simple cultivationPotential misfolding at high tempsInitial characterization, mutational studies
T. kodakarensisNative-like folding conditionsMore complex cultivationStructure-function studies requiring native folding
P. furiosusHyperthermophilic environmentSpecialized equipment neededStudies of thermal stability and post-translational modifications
Cell-free systemAvoids toxicity issuesLower yield, higher costRapid screening of variants or toxic proteins

For E. coli expression, use BL21(DE3) or Rosetta strains with temperature-inducible promoters. Supplement with rare codon plasmids to address codon bias issues. To enhance proper folding, consider co-expression with chaperones or slow induction at reduced temperatures (15-20°C) with extended expression times . For native-like conditions, homologous expression in M. jannaschii can be achieved using the recently developed genetic system, though transformation efficiency may be lower (approximately 10⁴ transformants per μg of plasmid DNA) .

How can I design a transformation protocol for introducing modified MJ0696 back into M. jannaschii?

To transform M. jannaschii with modified MJ0696 constructs, adapt the heat shock method described in the literature :

  • Grow M. jannaschii cells at 65°C until reaching an OD₆₀₀ of 0.5-0.7

  • Harvest cells by centrifugation at 3,000 rpm for 10 minutes under anaerobic conditions

  • Resuspend cell pellet in 500 μl of pre-reduced medium containing sodium sulfide

  • Incubate resuspended cells at 4°C for 30 minutes

  • Add 2 μg of linearized plasmid DNA containing your modified MJ0696 construct

  • Incubate at 4°C for an additional hour

  • Apply heat shock at 85°C for 45 seconds

  • Cool at 4°C for 10 minutes

  • Transfer the mixture to 10 ml of pre-reduced medium supplemented with 0.1% yeast extract

  • Incubate overnight at 80°C without shaking

  • Plate 100 μl on selective solid medium

This protocol typically yields approximately 10⁴ transformants per μg of plasmid DNA . For more efficient integration, design your construct with homologous regions flanking MJ0696 to facilitate double crossover recombination, as demonstrated with other M. jannaschii genes . Include selectable markers such as the mevinolin resistance gene for positive selection.

What purification strategies are most effective for isolating MJ0696 while maintaining its native conformation?

Purifying MJ0696 while preserving its native conformation requires consideration of its hyperthermophilic origin. A multi-step purification approach is recommended:

  • Heat treatment: Exploit the thermostability of MJ0696 by heating crude cell extracts to 70-80°C for 20-30 minutes to precipitate heat-labile host proteins

  • Affinity chromatography: If using a tagged version, consider a C-terminal tag (e.g., 6xHis or 3xFLAG-twin Strep tag) to minimize interference with protein folding

  • Size exclusion chromatography: For final polishing and determination of oligomeric state

Throughout purification, maintain reducing conditions (2-5 mM DTT or 2 mM β-mercaptoethanol) to prevent oxidation of cysteine residues, which are often critical for thermostable proteins. Buffers should mimic native conditions with elevated salt concentrations (300-500 mM NaCl) and pH values around 6.8-7.2. Consider using specialized hyperthermophile protein purification buffers containing osmolytes like trimethylamine N-oxide (TMAO) that may enhance stability.

How do I interpret circular dichroism (CD) spectroscopy data for MJ0696 at different temperatures?

When analyzing CD spectroscopy data for MJ0696 across temperature ranges:

  • Collect complete spectra (190-260 nm) at increasing temperatures (25°C to 95°C in 5-10°C increments)

  • Plot the molar ellipticity values against wavelength for each temperature

  • Identify characteristic spectral patterns:

    • α-helical content: negative peaks at 208 nm and 222 nm

    • β-sheet content: negative peak at 218 nm

    • Random coil: negative peak below 200 nm

Calculate the thermal melting profile by plotting the ellipticity at a specific wavelength (typically 222 nm for α-helical proteins) versus temperature. For MJ0696 from a hyperthermophile, expect minimal structural changes until temperatures approach 80-90°C. Compare the melting temperature (Tm) with the optimal growth temperature of M. jannaschii (80°C) to assess thermal adaptation. If MJ0696 maintains consistent secondary structure above 80°C, this supports its role in the thermoadaptation of M. jannaschii. Analysis of cooling curves can provide insights into refolding capacity and structural resilience.

How can I determine if MJ0696 forms oligomeric structures, and what techniques should I use to characterize them?

To investigate oligomerization of MJ0696, employ a combination of complementary techniques:

  • Size Exclusion Chromatography (SEC):

    • Run purified MJ0696 on a calibrated SEC column

    • Compare elution volume with protein standards of known molecular weight

    • Analyze peak shapes for potential equilibrium between different oligomeric states

  • Native PAGE:

    • Compare migration patterns with known molecular weight markers

    • Perform crosslinking experiments prior to electrophoresis to capture transient interactions

  • Dynamic Light Scattering (DLS):

    • Measure hydrodynamic radius at different protein concentrations

    • Analyze polydispersity to detect multiple species

  • Analytical Ultracentrifugation (AUC):

    • Perform sedimentation velocity experiments to determine sedimentation coefficients

    • Conduct sedimentation equilibrium runs to calculate precise molecular weights

  • Chemical Crosslinking Mass Spectrometry (CXMS):

    • Use crosslinkers of defined length to identify interacting regions

    • Analyze crosslinked peptides by mass spectrometry to map interaction interfaces

Compare results across methods and across different temperatures (25°C to 80°C) to assess temperature-dependent changes in oligomerization state. For proteins from hyperthermophiles, oligomerization often increases with temperature as a mechanism for thermostabilization.

What are the most reliable methods for assessing potential enzymatic activity of the uncharacterized MJ0696 protein?

As MJ0696 is uncharacterized, a systematic approach to activity screening is necessary:

  • Bioinformatic prediction:

    • Identify conserved domains and sequence similarity to characterized enzymes

    • Predict potential substrates based on genomic context and co-expressed genes

  • High-throughput screening:

    • Design substrate libraries based on bioinformatic predictions

    • Perform activity assays at elevated temperatures (70-85°C) to mimic native conditions

    • Monitor general reaction indicators (NAD(P)H consumption, Pi release, pH changes)

  • Metabolite profiling:

    • Compare metabolomes of wild-type and MJ0696 knockout/overexpression strains

    • Identify accumulated or depleted metabolites that may indicate substrate or product

  • Protein interaction studies:

    • Identify binding partners through pull-down assays or Y2H screens

    • Map metabolic pathways that may involve MJ0696 based on interactors

All activity assays should be performed across a temperature range of 30-90°C with particular focus on the physiological temperature of M. jannaschii (80°C). Consider the effect of various cofactors including metal ions (Fe²⁺, Ni²⁺, Co²⁺) common in methanogenic enzymes. Control experiments using heat-denatured protein and varying pH conditions should be included to confirm enzymatic rather than chemical catalysis.

How do post-translational modifications of MJ0696 differ between native and recombinant expression systems?

Post-translational modifications (PTMs) of hyperthermophilic proteins often contribute significantly to their stability and function. When comparing MJ0696 expressed in native versus recombinant systems:

  • Employ high-resolution mass spectrometry (MS) techniques:

    • Use both bottom-up (tryptic digestion) and top-down (intact protein) MS approaches

    • Look for mass shifts indicative of common archaeal PTMs including methylation, acetylation, and phosphorylation

    • Apply electron transfer dissociation (ETD) fragmentation to preserve labile PTMs

  • Compare PTM profiles between:

    • Native MJ0696 purified directly from M. jannaschii

    • Recombinant MJ0696 expressed in E. coli

    • Recombinant MJ0696 expressed in archaeal hosts (T. kodakarensis)

Differences in PTM patterns may explain discrepancies in thermal stability, activity, or oligomerization between native and recombinant proteins. For archaeal proteins, particularly look for methylation of lysine residues and N-terminal acetylation, which are common stabilizing modifications in hyperthermophiles. When expressing MJ0696 in heterologous systems, consider co-expression with archaeal PTM enzymes to more closely mimic native modifications.

What role does MJ0696 play in the stress response of Methanocaldococcus jannaschii under varying environmental conditions?

To investigate MJ0696's role in stress response:

  • Generate an MJ0696 knockout strain using the genetic system for M. jannaschii

  • Create an overexpression strain with a regulated promoter (such as P*)

  • Subject these strains and wild-type to various stressors:

    • Temperature stress (65°C, 85°C, 90°C)

    • Oxidative stress (trace O₂ exposure)

    • pH fluctuations (pH 5.5-8.0)

    • Nutrient limitation

  • Analyze phenotypic responses through:

    • Growth rate measurements

    • Cell viability assays

    • Metabolomic profiling

    • Transcriptomic analysis to identify compensatory mechanisms

  • Perform complementation studies:

    • Re-introduce native MJ0696

    • Express point mutants targeting predicted functional domains

Correlation of MJ0696 expression levels with stress conditions using qRT-PCR can provide additional evidence for its role in specific stress responses. Comparative analysis with homologs from mesophilic or psychrophilic methanogens can elucidate adaptation-specific functions. If MJ0696 expression increases during specific stress conditions, this suggests a protective role that could inform functional characterization.

How can cryo-EM be optimized for structural determination of MJ0696 in its native conformation?

Cryo-electron microscopy (cryo-EM) offers advantages for structural determination of challenging proteins like MJ0696. Optimize your cryo-EM approach with these methodological considerations:

  • Sample preparation:

    • Purify MJ0696 to high homogeneity (>95% by SDS-PAGE)

    • Assess sample monodispersity by negative stain EM before proceeding to cryo-EM

    • Test multiple buffer conditions to prevent aggregation and optimize particle distribution

    • Consider GraFix (gradient fixation) to stabilize potential oligomeric complexes

  • Grid preparation:

    • Test multiple grid types (Quantifoil, C-flat, UltrAuFoil)

    • Optimize blotting conditions (time, force, humidity)

    • Consider adding detergents (0.01-0.05% n-dodecyl β-D-maltoside) to prevent protein adsorption to the air-water interface

  • Data collection:

    • Collect at moderate defocus values (-1.0 to -2.5 μm)

    • Use beam-tilt pairs for initial model generation if no reference structure is available

    • Implement dose-fractionation with motion correction

  • Data processing:

    • Apply Bayesian particle polishing

    • Perform 3D classification to separate different conformational states

    • Use local refinement for flexible regions

For MJ0696 specifically, consider collecting data at both ambient temperature and elevated temperature (using heated stage modifications) to capture temperature-dependent conformational changes relevant to its function in a hyperthermophile. If oligomerization is temperature-dependent, compare structures obtained under different temperature conditions to understand thermally induced assembly mechanisms.

What strategies can address the challenges of crystallizing hyperthermophilic proteins like MJ0696 for X-ray crystallography?

Crystallizing hyperthermophilic proteins presents unique challenges that require specialized approaches:

  • Temperature considerations:

    • Set up parallel crystallization screens at both room temperature and elevated temperatures (37-60°C)

    • For initial screens at high temperatures, use oil barrier methods to prevent rapid evaporation

    • Consider temperature as a crystallization variable, starting crystal growth at higher temperatures and gradually cooling

  • Buffer composition:

    • Include stabilizing agents like trimethylamine N-oxide (TMAO) or potassium glutamate

    • Maintain reducing conditions with 1-5 mM DTT or TCEP to prevent oxidation

    • Test higher salt concentrations (300-500 mM) than typically used for mesophilic proteins

  • Surface engineering:

    • Identify and mutate surface residues with high conformational entropy (Lys, Glu, Gln) to alanine

    • Consider the SER (Surface Entropy Reduction) approach to create crystal contacts

    • Design constructs with thermostable fusion partners (T4 lysozyme, BRIL)

  • Crystallization techniques:

    • Implement microseed matrix screening using crushed microcrystals

    • Try counter-diffusion methods in capillaries for slower, more ordered crystal growth

    • Consider lipidic cubic phase (LCP) even for soluble proteins as it provides a stabilizing environment

For MJ0696 specifically, perform limited proteolysis at elevated temperatures (60-70°C) to identify stable domains that might crystallize more readily than the full-length protein. Consider in situ data collection at room temperature to avoid potential conformational changes during cryocooling.

What are the most promising research directions for understanding the physiological role of MJ0696 in Methanocaldococcus jannaschii?

The uncharacterized nature of MJ0696 offers rich opportunities for fundamental discoveries about archaeal biology and extremophile adaptation. Priority research directions should include:

  • Comprehensive genetic analysis:

    • Generate clean deletion mutants using the newly established genetic systems for M. jannaschii

    • Perform complementation studies with wild-type and mutant variants

    • Conduct comparative genomic analyses across methanogen species to identify conserved genomic neighborhoods

  • Structural characterization:

    • Determine high-resolution structures at physiologically relevant temperatures

    • Map temperature-dependent conformational changes

    • Identify potential ligand binding sites through computational prediction and experimental validation

  • Interactome mapping:

    • Identify protein-protein and protein-nucleic acid interactions

    • Reconstruct metabolic or signaling pathways involving MJ0696

  • Evolutionary analysis:

    • Trace the evolutionary history of MJ0696 across archaeal lineages

    • Identify signatures of positive selection that might indicate functional importance

    • Perform ancestral sequence reconstruction to test hypotheses about evolutionary adaptation to high temperatures

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.