Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0703.1 (MJ0703.1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MJ0703.1; Uncharacterized protein MJ0703.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0703.1
Target Protein Sequence
MVGNMNIRDKIKSIKNWINFIKPIITIVGIVISAVAFTISILWGMLFLILFLILITFSKT IRKILSKKERSYQGLILSIIGSIIIISIIVYSHCYIEFKLLI
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the MJ0703.1 gene in Methanocaldococcus jannaschii?

MJ0703.1 is located on the main circular chromosome of M. jannaschii, which is approximately 1.66 megabase pairs with a G+C content of 31.4% . The genomic context analysis reveals neighboring genes that may provide clues to functional associations through operonic organization. To determine the genomic context:

  • Access the complete genome sequence using GenBank accession number L77117

  • Analyze flanking regions using bioinformatic tools to identify potential operons

  • Compare synteny with related archaeal species to identify conserved genomic neighborhoods

What expression systems are most effective for recombinant production of MJ0703.1?

When expressing thermophilic archaeal proteins like MJ0703.1, several expression systems can be considered:

Expression SystemAdvantagesDisadvantagesRecommended Conditions
E. coli BL21(DE3)High yield, easy manipulationPotential misfolding of archaeal proteinsIPTG induction at 18°C for 16 hours
E. coli RosettaBetter codon usage for archaeal genesModerate yield0.5 mM IPTG, 25°C induction
Thermophilic expression hostsProper folding environmentMore complex cultivationNative temperature (80°C) cultivation

For optimal expression:

  • Design codon-optimized synthetic genes based on the target expression host

  • Include a hexahistidine tag (avoid larger tags that may interfere with thermostable protein folding)

  • Begin with small-scale expression trials across multiple temperatures (18°C, 25°C, 37°C)

  • Analyze soluble versus insoluble fractions to determine optimal conditions

  • Scale up using the optimized parameters

This methodological approach accounts for the hyperthermophilic origin of M. jannaschii proteins, which may require modified expression protocols compared to mesophilic proteins.

How can researchers effectively purify recombinant MJ0703.1 protein while maintaining structural integrity?

Purification strategies for MJ0703.1 must account for its thermophilic nature:

  • Initial heat treatment (70-80°C for 20 minutes) to denature E. coli host proteins while keeping MJ0703.1 in solution

  • Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins

  • Ion exchange chromatography based on theoretical isoelectric point

  • Size exclusion chromatography for final polishing and buffer exchange

Recommended buffers should incorporate stabilizing agents:

  • Base buffer: 50 mM HEPES pH 7.5, 300 mM NaCl

  • Addition of 5-10% glycerol to prevent aggregation

  • Consider including 1-2 mM DTT if cysteine residues are present

Quality control checkpoints should include SDS-PAGE, Western blotting, and thermal shift assays to confirm proper folding and stability at elevated temperatures characteristic of M. jannaschii's native environment.

What bioinformatic approaches can predict the potential function of MJ0703.1?

A comprehensive bioinformatic analysis workflow for MJ0703.1 includes:

  • Primary sequence analysis using BLAST against multiple databases (nr, SwissProt, PDB)

  • Motif and domain identification using InterPro, SMART, and CDD

  • Secondary structure prediction via PSIPRED and JPred

  • Tertiary structure prediction using AlphaFold2 or RoseTTAFold

  • Structural comparison against known folds using DALI and TM-align

  • Functional prediction using:

    • Gene neighborhood analysis

    • Phylogenetic profiling

    • Protein-protein interaction network inference

The effectiveness of these approaches is enhanced by M. jannaschii's position as a deeply-branching archaeon, potentially revealing evolutionary insights into protein function conservation. Results should be validated against experimental data where available, with predictions ranked by confidence levels based on multiple independent methods.

How does temperature affect the structural stability and activity of MJ0703.1?

Thermostability analysis of MJ0703.1 should employ multiple complementary techniques:

TechniqueParameter MeasuredTemperature RangeExpected Results
Circular DichroismSecondary structure integrity25-100°CMinimal changes up to 80°C
Differential Scanning CalorimetryMelting temperature (Tm)20-120°CTm likely >90°C
Thermal Shift AssayUnfolding profile25-99°CGradual unfolding above 85°C
Activity AssaysFunctional parameters37-95°COptimal activity expected 80-85°C

Activity measurements should be conducted using buffers pre-heated to the target temperature, with appropriate controls to account for substrate stability at elevated temperatures. Experimental design should include technical replicates (n=3) and biological replicates from independent protein preparations (n=3) to ensure statistical robustness .

What approaches are most effective for determining the oligomeric state of MJ0703.1?

Determining the oligomeric state requires a multi-technique approach:

  • Size exclusion chromatography calibrated with appropriate molecular weight standards

  • Native PAGE analysis with gradient gels (4-20%)

  • Dynamic light scattering to determine the hydrodynamic radius

  • Analytical ultracentrifugation (sedimentation velocity and equilibrium)

  • Chemical crosslinking followed by SDS-PAGE analysis

  • Mass spectrometry under native conditions

Results from these techniques should be analyzed collectively, as individual methods may have limitations when applied to thermophilic proteins. Data interpretation should consider:

  • The effect of temperature on oligomerization

  • Buffer conditions that may affect quaternary structure

  • Concentration-dependent oligomerization phenomena

This comprehensive approach allows confident assignment of the native oligomeric state in conditions approximating M. jannaschii's natural environment.

How can researchers design experiments to resolve conflicting structural predictions for MJ0703.1?

When computational predictions yield conflicting structural models for MJ0703.1:

  • Prioritize experimental validation through limited proteolysis coupled with mass spectrometry to identify domain boundaries and stable fragments

  • Design truncation constructs based on these boundaries for separate expression and characterization

  • Employ hydrogen-deuterium exchange mass spectrometry to determine solvent-accessible regions

  • Utilize site-directed mutagenesis to test the functional importance of predicted active site residues

  • Consider small-angle X-ray scattering (SAXS) to obtain low-resolution structural envelopes

  • For definitive structure determination:

    • X-ray crystallography (challenging but highest resolution)

    • Cryo-electron microscopy (especially for larger complexes)

    • NMR spectroscopy for smaller domains or fragments

Statistical analysis of results should employ appropriate methods for each technique, with special attention to distinguishing between experimental artifacts and genuine structural features. Interpretation of contradictory results should follow a systematic elimination approach rather than arbitrary selection of convenient data points.

What experimental design approaches are most appropriate for determining if MJ0703.1 contains intrinsically disordered regions?

Detecting intrinsically disordered regions (IDRs) in hyperthermophilic proteins requires specialized approaches:

  • Computational prediction using multiple algorithms (PONDR, IUPred, DisEMBL)

  • Biophysical characterization:

    • Circular dichroism spectroscopy at multiple temperatures

    • NMR spectroscopy focusing on chemical shift dispersion

    • SAXS analysis with Kratky plots

  • Limited proteolysis with time-course sampling

  • Hydrogen-deuterium exchange with mass spectrometry analysis

Experimental design considerations:

  • Factorial design incorporating multiple temperatures (25°C, 60°C, 80°C) and buffer conditions

  • Technical replicates (n=3) for each condition

  • Controls including known structured and disordered proteins

  • Statistical analysis of results using ANOVA for multi-factor experiments

Results interpretation must account for the unique properties of hyperthermophilic proteins, which may exhibit characteristics easily mistaken for disorder at lower temperatures but represent adaptive flexibility at physiological temperatures (80-85°C).

How can researchers design assays to identify potential enzymatic activities for MJ0703.1?

Addressing the uncharacterized nature of MJ0703.1 requires systematic activity screening:

  • Structure-based function prediction:

    • Identify potential active site pockets

    • Analyze electrostatic surface properties

    • Compare with characterized enzyme active sites

  • High-throughput screening approaches:

    • Metabolite profiling using LC-MS/MS

    • Activity-based protein profiling with chemical probes

    • Substrate depletion assays with metabolite mixtures

  • Targeted assays based on genomic context:

    • Design assays for activities suggested by operonic organization

    • Test potential substrates from related metabolic pathways

Assay TypeSubstrate RangeDetection MethodControls Required
OxidoreductaseNAD(P)H, flavinsSpectrophotometricHeat-inactivated protein
Hydrolasep-nitrophenyl estersColorimetricNo-enzyme control
TransferaseRadiolabeled substratesScintillation countingSpecific inhibitors
IsomeraseEpimers, structural isomersHPLCKnown isomerases

Experimental design should include randomized block design to control for batch effects , with appropriate statistical analysis using multiple comparison corrections when screening numerous potential substrates.

What considerations are important when designing knockdown or knockout experiments to study MJ0703.1 function in vivo?

Genetic manipulation of M. jannaschii presents significant challenges due to its extremophilic nature:

  • Consider alternative genetic systems:

    • Closely related mesophilic methanogens as model systems

    • Heterologous expression in genetic tractable archaea (e.g., Thermococcus kodakarensis)

  • If pursuing M. jannaschii genetic modification:

    • Design specialized vectors with thermostable selection markers

    • Optimize transformation protocols for high pressure and temperature conditions

    • Consider CRISPR-Cas9 systems adapted for archaeal systems

  • Experimental design approach:

    • Establish clear phenotypic readouts based on predicted function

    • Implement conditional knockdown systems if MJ0703.1 is potentially essential

    • Design complementation experiments with mutant variants

  • Controls and validation:

    • Include wild-type controls in all experimental batches

    • Verify knockdown/knockout at both transcript and protein levels

    • Conduct rescue experiments with exogenous complementation

Statistical power analysis should be performed prior to experimentation to determine adequate sample sizes , with consideration for the increased variability often observed in extremophile cultivation.

How should researchers approach the analysis of high-throughput functional genomics data to contextualize MJ0703.1?

When analyzing large-scale datasets to understand MJ0703.1 function:

  • Transcriptomic analysis workflow:

    • Compare expression profiles across multiple growth conditions

    • Identify co-expressed genes forming potential functional modules

    • Apply appropriate normalization methods for RNA-Seq data

    • Use statistical approaches like DESeq2 or edgeR for differential expression

  • Proteomic data integration:

    • Analyze protein abundance changes correlating with MJ0703.1

    • Examine post-translational modifications specific to different conditions

    • Apply appropriate statistical tests for proteomics data (e.g., MSstats)

  • Network analysis:

    • Construct protein-protein interaction networks

    • Perform pathway enrichment analysis

    • Apply graph theory metrics to identify network positions

  • Data visualization and interpretation:

    • Generate heatmaps of expression data with hierarchical clustering

    • Create network visualizations highlighting functional modules

    • Develop integrated models incorporating multiple data types

Statistical considerations should include correction for multiple testing (e.g., Benjamini-Hochberg procedure) and appropriate treatment of missing values in high-throughput datasets .

What statistical approaches are most appropriate for analyzing thermal stability data for MJ0703.1 variants?

When comparing thermal stability across multiple protein variants:

  • Experimental design recommendations:

    • Randomized complete block design to control for batch effects

    • Multiple technical replicates (n≥3) per variant

    • Include wild-type protein as internal control in each experiment

  • Statistical analysis workflow:

    • Test for normality using Shapiro-Wilk test

    • For normally distributed data:

      • ANOVA followed by post-hoc tests (Tukey's HSD for all pairwise comparisons)

      • Linear mixed effects models for complex designs with random factors

    • For non-normal data:

      • Non-parametric alternatives (Kruskal-Wallis followed by Dunn's test)

  • Regression approaches for structure-stability relationships:

    • Multiple linear regression for identifying contributing factors

    • Polynomial regression for non-linear stability profiles

    • Principal component analysis for reducing dimensionality when comparing multiple parameters

  • Visualization strategies:

    • Box plots showing distribution of stability measurements

    • Scatter plots with error bars for Tm vs. mutation position

    • Heat maps for multiple parameters across variants

Power analysis should be conducted to ensure sufficient replication for detecting biologically meaningful differences in thermal stability .

How can researchers effectively address contradictory results between in silico predictions and experimental data for MJ0703.1?

When faced with discrepancies between computational predictions and experimental results:

This structured approach avoids confirmation bias and embraces the iterative nature of scientific discovery, particularly important for uncharacterized proteins where gold standard references are lacking.

What approaches can identify functional homologs of MJ0703.1 across archaea and bacteria?

Identifying distant homologs of MJ0703.1 requires sophisticated approaches beyond standard BLAST:

  • Sequence-based methods:

    • Position-Specific Iterated BLAST (PSI-BLAST) with multiple iterations

    • Hidden Markov Model (HMM) profile searches using HMMER

    • Sensitive alignment methods like MAFFT-L-INS-i for divergent sequences

  • Structure-based approaches:

    • Threading methods (I-TASSER, PHYRE2)

    • Structural alignment of predicted models

    • Fold recognition using profile-profile alignments

  • Genomic context methods:

    • Gene neighborhood conservation analysis

    • Phylogenetic profiling across diverse genomes

    • Conservation of gene fusions or operonic arrangements

  • Integrated analysis workflow:

    • Score potential homologs using multiple independent methods

    • Weight evidence based on phylogenetic distance

    • Develop confidence tiers for predicted functional relationships

Statistical validation should include bootstrapping for phylogenetic analyses and appropriate measures of significance for sequence similarity beyond simple E-values.

How can researchers design experiments to test whether MJ0703.1 represents an ancestral protein function or a specialized adaptation?

Distinguishing between ancestral and specialized functions requires systematic evolutionary analysis:

  • Comparative functional assays:

    • Express and characterize homologs from diverse archaeal and bacterial lineages

    • Test activity under varied conditions (temperature, salt, pressure)

    • Measure kinetic parameters to identify specialization signatures

  • Ancestral sequence reconstruction:

    • Build robust phylogenetic trees with maximum likelihood methods

    • Infer ancestral sequences at key evolutionary nodes

    • Express and characterize reconstructed ancestral proteins

  • Domain architecture analysis:

    • Compare domain organization across homologs

    • Identify fusions, fissions, and rearrangements

    • Test functional independence of individual domains

  • Experimental design considerations:

    • Factorial design incorporating phylogenetic diversity and environmental conditions

    • Controls including proteins with known evolutionary histories

    • Statistical framework for comparing phylogenetic signal to functional parameters

This approach yields insights not only into MJ0703.1 specifically but also into broader questions of protein evolution in extremophiles and the early evolution of life.

What experimental design is optimal for evaluating the potential of MJ0703.1 for biotechnological applications?

When investigating biotechnological potential:

  • Stability characterization under industrial conditions:

    • Thermostability in various buffer systems

    • pH tolerance range

    • Organic solvent compatibility

    • Long-term storage stability

  • Activity screening design:

    • High-throughput substrate screening

    • Reaction condition optimization (factorial design)

    • Enzyme kinetics under varying conditions

    • Substrate specificity profiling

  • Protein engineering considerations:

    • Structure-guided mutagenesis for improved properties

    • Directed evolution strategy design

    • Chimeric protein construction with mesophilic homologs

  • Application-specific testing:

    • Immobilization strategies and activity retention

    • Performance in relevant reaction systems

    • Compatibility with existing industrial processes

Statistical design should incorporate response surface methodology to efficiently identify optimal conditions , with appropriate controls for enzyme stability and activity under standard conditions.

How can researchers design experiments to investigate the role of post-translational modifications in MJ0703.1 function?

Post-translational modifications (PTMs) in archaeal proteins require specialized investigative approaches:

  • PTM identification workflow:

    • Mass spectrometry analysis with multiple fragmentation methods

    • Enrichment strategies for specific modifications

    • Western blotting with modification-specific antibodies

  • Site-directed mutagenesis approach:

    • Mutate potential modification sites to non-modifiable residues

    • Create mimetic mutations (e.g., glutamate for phosphorylation)

    • Evaluate functional consequences through activity assays

  • Temporal dynamics investigation:

    • Time-course experiments during growth phases

    • Stress response analyses

    • Pulse-chase labeling for modification turnover

  • Enzyme reconstitution studies:

    • Identify modification enzymes through bioinformatics

    • Reconstitute modification systems in vitro

    • Evaluate modification stoichiometry and specificity

Experimental design should include appropriate controls for specificity of detection methods and consider the unique chemistry of the archaeal cellular environment, which may contain unusual modifications not common in bacterial or eukaryotic systems.

What integrative approaches can resolve the complete functional characterization of MJ0703.1?

A comprehensive research roadmap for complete functional characterization:

  • Phase I: Initial characterization

    • Bioinformatic analysis and prediction

    • Expression, purification, and basic biochemical characterization

    • Preliminary structural studies

  • Phase II: Functional determination

    • Substrate screening and activity assays

    • Structural determination (X-ray crystallography, Cryo-EM)

    • Mutagenesis of predicted functional residues

  • Phase III: Biological context

    • Interaction partner identification

    • Metabolic pathway reconstruction

    • In vivo functional studies in model systems

  • Phase IV: Evolutionary and applied aspects

    • Comparative studies across archaeal lineages

    • Ancestral reconstruction and evolutionary analysis

    • Biotechnological application development

This integrated approach combines multiple disciplines and methodologies, with statistical validation at each stage and iterative refinement of hypotheses based on accumulated evidence.

How should researchers design robust controls when studying an uncharacterized protein like MJ0703.1?

Robust control design for uncharacterized protein research:

  • Positive control strategies:

    • Well-characterized proteins with similar predicted functions

    • Known proteins from the same structural family

    • Tagged versions of the protein for tracking experiments

  • Negative control approaches:

    • Heat-denatured protein preparations

    • Site-directed mutants of predicted catalytic residues

    • Empty vector controls for expression studies

  • Specificity controls:

    • Related proteins from the same organism

    • Homologs from mesophilic organisms

    • Randomized protein libraries of similar size/composition

  • Technical validation controls:

    • Multiple purification batches to assess reproducibility

    • Different tags or tag positions to verify tag independence

    • Multiple detection methods for key findings

This comprehensive control strategy ensures that observed phenomena are specifically attributable to MJ0703.1 and not to experimental artifacts or general protein properties, particularly important when characterizing proteins from extremophiles where standard assumptions may not apply.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.