Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0704 (MJ0704)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Methanocaldococcus jannaschii Uncharacterized Protein MJ0704 (MJ0704)

MJ0704 is a full-length recombinant protein derived from Methanocaldococcus jannaschii, a hyperthermophilic methanogen (anaerobic archaeon) renowned for its extreme environmental adaptations . The protein is annotated as "uncharacterized" due to limited functional data in public databases, despite its inclusion in the first archaeal genome sequenced in 1996 . Its recombinant form is commercially available with an N-terminal His tag for purification and structural studies .

Production and Availability

MJ0704 is produced via recombinant expression in E. coli, with purification facilitated by its His tag . Key considerations include:

  • Purification Method: Affinity chromatography (via His tag) and SDS-PAGE validation .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Applications: Primarily used for structural studies or as a control in biochemical assays .

Genomic Annotation Challenges

Over one-third of M. jannaschii’s genome remains uncharacterized, with MJ0704 classified among these enigmatic proteins . Unlike functionally annotated proteins (e.g., FprA, a sulfite reductase) , MJ0704 lacks experimental evidence linking it to metabolic pathways or enzymatic activity .

Comparative Insights

While MJ0704 shares no direct homology with characterized DEAD-box helicases (e.g., MjDEAD, a dimeric RNA helicase) , its full-length expression suggests potential roles in nucleic acid metabolism or stress response, common in extremophiles.

Future Research Directions

AreaRationale
Functional ScreensHigh-throughput assays to test ATPase or nucleic acid-binding activity
Structural AnalysisX-ray crystallography to identify conserved motifs or dimerization interfaces (as seen in other M. jannaschii proteins)
Genetic KnockoutsLeveraging M. jannaschii’s emerging genetic tools to probe in vivo roles

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, kindly indicate them in your order for our fulfillment.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
MJ0704; Uncharacterized protein MJ0704
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Target Names
MJ0704
Target Protein Sequence
MFAFEGFKWEIVEIFDWKGLKKLQTTFQNYLLILSMIVSIAVVVAIKNYDSLWSLITNSS DSSNFLTVGSILATISALLVSISWVIIQTSSDRLSNILMWIWVRDVRFLTFVVISFTTVF LFILISLTHVQLHVIDYGIIYYVIMLNFLMYALYIKAFANVINPKYAVDLILRDKDIGDK SGGYGDLTDAESRLFAVYEIIEKRIKVGDVYAVIKCLNMINKNFNKYWMFIKDEKREKYL RDFLRILSKLRVEYRKNCLNRKNKPYSKKGLEAFKKTEFIVSFYKTIEEKIKTRDINSIN KFLSETYNNISNYEMFNDKTYLEIFVHHLKELLEKYEKEKNENKLDEEIFNELKDELEKL INKCNNKLRELESQNNN
Uniprot No.

Target Background

Database Links

KEGG: mja:MJ_0704

STRING: 243232.MJ_0704

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Why is studying uncharacterized proteins like MJ0704 scientifically significant?

Studying uncharacterized proteins like MJ0704 is crucial for several scientific reasons:

  • Completing the functional annotation of the M. jannaschii genome, which was the first Archaeal genome sequenced (1996) and serves as a reference model for archaeal biology .

  • Despite advances in genomics, more than a third of the M. jannaschii genome remains functionally uncharacterized, representing significant knowledge gaps .

  • Uncharacterized proteins may have novel enzymatic activities or structural features not found in better-studied organisms, potentially leading to new biotechnological applications.

  • Understanding archaeal proteins contributes to our knowledge of evolution and the diversity of molecular mechanisms across all domains of life.

  • M. jannaschii is a thermophilic methanogen, and studying its proteins can provide insights into adaptations to extreme environments and unique metabolic pathways.

What experimental designs are most effective for functional characterization of uncharacterized archaeal proteins?

For uncharacterized archaeal proteins like MJ0704, a multi-faceted experimental approach is recommended:

  • Comparative Sequence Analysis: Begin with bioinformatic analysis comparing MJ0704 to characterized proteins across databases. Look for conserved domains, motifs, and structural predictions that might suggest function .

  • True Experimental Design with Controls: Implement a randomized experimental design with both positive and negative controls when testing potential functions . This design should include:

    • Experimental group: Purified recombinant MJ0704

    • Control groups: Known proteins with similar predicted functions and negative controls

    • Variable manipulation: Systematic testing of reaction conditions (temperature, pH, potential substrates)

    • Random distribution: Multiple replicates with randomized sample handling to control for extraneous variables

  • Structure-Function Analysis: Determine the protein structure using X-ray crystallography or cryo-EM to guide functional hypotheses. The recent advances in cryo-EM have been particularly useful for archaeal proteins, as demonstrated with M. jannaschii RNase P .

  • Genetic Approaches: Implement gene knockout or overexpression studies in model archaeal systems. While M. jannaschii itself is challenging to manipulate genetically, related species like Methanococcus maripaludis provide genetically tractable alternatives .

  • Metabolic Context Analysis: Consider the genomic context and potential metabolic pathways where MJ0704 might function, using resources like the MjCyc pathway-genome database .

What are the optimal conditions for expressing recombinant MJ0704 in heterologous systems?

Based on established protocols for recombinant archaeal proteins:

  • Expression System Selection: Escherichia coli is typically the preferred expression system, specifically using strains optimized for heterologous expression of archaeal proteins (BL21(DE3), Rosetta, or ArcticExpress for challenging proteins) .

  • Vector Design Considerations:

    • Include an N-terminal or C-terminal tag (His-tag is common) to facilitate purification

    • Use a promoter system with tunable expression (T7 or tac promoter)

    • Consider codon optimization for E. coli expression

    • For thermostable proteins, ensure the vector is compatible with expression at lower temperatures than the native environment

  • Expression Conditions:

    • Induction: 0.1-0.5 mM IPTG, typically at OD600 of 0.6-0.8

    • Temperature: 18-30°C post-induction (lower temperatures often improve folding of archaeal proteins)

    • Duration: 4-16 hours (protein-dependent)

  • Purification Strategy:

    • Heat treatment (70-80°C for 10 min) can be used as an initial purification step, as demonstrated for other M. jannaschii proteins

    • Anion exchange chromatography on a MonoQ HR column with a linear gradient of 0 to 1 M NaCl in 25 mM Tris (pH 7.5)

    • Final polishing step using size exclusion chromatography if needed

How should storage and handling of recombinant MJ0704 be optimized for functional studies?

For optimal stability and activity of recombinant MJ0704:

  • Storage Buffer: Store in Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Storage Temperature: Store at -20°C for short-term use, or -80°C for extended storage .

  • Working Aliquots: Prepare small working aliquots to avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week .

  • Freeze-Thaw Considerations: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Pre-Assay Handling: Before functional assays, consider buffer exchange to remove glycerol if it might interfere with planned experiments.

How can genomic context analysis be applied to predict the function of MJ0704?

Genomic context analysis offers powerful insights for uncharacterized proteins:

  • Operonic Structure Analysis: Examine whether MJ0704 is part of an operon with functionally characterized genes, which might suggest related functions.

  • Comparative Genomics Approach:

    • Analyze the genomic neighborhood of MJ0704 across multiple archaeal species

    • Identify conserved gene clusters that include MJ0704 orthologs

    • Use tools like the MjCyc pathway-genome database to identify potential metabolic pathways

  • Phylogenetic Profiling:

    • Create a presence/absence matrix of MJ0704 across diverse species

    • Correlate this profile with known metabolic capabilities or environmental adaptations

    • Identify proteins with similar phylogenetic profiles that might be functionally related

  • Pathway Hole Filling Analysis: Similar to how MJ1598 was detected as EC 2.4.2.21 (nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase) through pathway analysis, apply computational approaches to identify potential enzymatic roles for MJ0704 based on missing reactions in known pathways .

What bioinformatic approaches can help resolve the function of MJ0704?

A multi-tiered bioinformatic strategy is recommended:

  • Sequence-Based Analysis:

    • Position-Specific Iterative BLAST (PSI-BLAST) to detect distant homologs

    • Hidden Markov Model (HMM) profile searches against protein family databases

    • Analysis of conserved residues that might indicate catalytic or binding sites

  • Structural Prediction and Analysis:

    • Use AlphaFold or RoseTTAFold to generate structural models

    • Compare predicted structures to known protein structures using tools like DALI

    • Identify potential active sites or binding pockets using CASTp or similar tools

  • Integration with Experimental Data:

    • Combine computational predictions with limited proteolysis experiments to validate domain boundaries

    • Use predicted structures to design targeted mutagenesis experiments for functional validation

  • Function Prediction Algorithms:

    • Apply specialized function prediction tools like EFICAz or COFACTOR

    • Use protein-protein interaction predictions to identify potential binding partners

How can experimental designs address the challenges of functional verification for archaeal proteins?

Advanced experimental approaches for functional verification include:

  • Activity-Based Protein Profiling (ABPP):

    • Use chemical probes designed to react with specific enzyme classes

    • Apply to purified MJ0704 to detect potential enzymatic activities

  • Metabolomics Approaches:

    • Incubate MJ0704 with cell extracts or metabolite pools

    • Use mass spectrometry to detect changes in metabolite profiles

    • Apply techniques similar to those used to characterize the MJ0044 gene product

  • Thermal Shift Assays (TSA):

    • Screen for ligand binding by monitoring protein thermal stability

    • Test a library of potential substrates, cofactors, or inhibitors

    • Identify compounds that specifically alter the thermal denaturation profile

  • Protein Interaction Studies:

    • Apply techniques like pull-down assays or crosslinking mass spectrometry

    • Identify protein partners that might provide functional context

    • Consider using the native M. jannaschii cellular environment when possible

  • Parallel Reaction Monitoring:

    • Design a systematic screening approach testing multiple potential substrates in parallel

    • Implement a discontinuous assay similar to that used for IP kinase :

      • Incubate MJ0704 at 55°C in reaction mixture containing potential substrates

      • Include 7 mM MgCl₂, ATP, and appropriate buffers

      • After incubation, analyze reaction products using appropriate analytical techniques

How should researchers address contradictory results when studying uncharacterized proteins?

When confronting contradictory results for proteins like MJ0704:

  • Systematic Evaluation of Experimental Variables:

    • Create a detailed matrix of experimental conditions, cataloging all variables that might affect results

    • Systematically test each variable while controlling for others

    • Consider unique requirements of archaeal proteins, such as temperature, salt concentration, or specific cofactors

  • Multi-Method Verification:

    • Apply orthogonal experimental approaches to test the same hypothesis

    • Consider that apparent contradictions may reflect different aspects of a multifunctional protein

    • Evaluate the sensitivity and specificity of each method used

  • Comparative Analysis Framework:

    • Examine similar proteins with characterized functions and how experimental conditions affect their activity

    • Consider lessons from MJ0044, which was initially misidentified as a phosphomevalonate kinase but later found to phosphorylate isopentenyl phosphate

  • Evaluate Protein Quality and Modification State:

    • Verify protein folding and oligomeric state using techniques like circular dichroism, size exclusion chromatography, or native mass spectrometry

    • Consider post-translational modifications that might be present in the native protein but absent in recombinant versions

What considerations are important when comparing MJ0704 to other uncharacterized proteins in M. jannaschii?

When conducting comparative analyses:

  • Establish a Standardized Experimental Framework:

    • Use consistent expression, purification, and assay conditions when testing multiple proteins

    • Create a structured data collection system that facilitates direct comparisons

  • Apply Phylogenetic Context:

    • Consider evolutionary relationships when interpreting functional similarities and differences

    • Examine whether MJ0704 belongs to a protein family with other members in M. jannaschii

  • Integrated Dataset Analysis:

    • Compare expression patterns, protein-protein interactions, and genomic context

    • Use the complete MjCyc pathway-genome database to provide metabolic context

  • Structural Comparison Methodology:

    • Analyze structural similarities beyond sequence homology

    • Consider that structurally similar proteins may have divergent functions

  • Paralog Resolution Strategy:

    • Apply the techniques used to resolve the functions of paralogs MJ0865 and MJ1487 in M. jannaschii

    • Consider that MJ0704 might have paralogs with related but distinct functions

What statistical approaches are most appropriate for analyzing functional assay data for uncharacterized proteins?

For robust statistical analysis:

  • Experimental Design Statistics:

    • Implement true experimental designs with appropriate controls and randomization

    • Use power analysis to determine appropriate sample sizes before conducting experiments

    • Consider factorial designs when testing multiple variables that might affect protein function

  • Data Analysis Framework:

    • Apply appropriate transformations if data do not meet assumptions of parametric tests

    • Use ANOVA with post-hoc tests for comparing multiple conditions

    • Implement regression analysis for examining relationships between variables (e.g., enzyme kinetics)

  • Specialized Methods for Functional Discovery:

    • Consider Bayesian approaches for integrating prior knowledge with experimental data

    • Apply machine learning techniques for pattern recognition in complex datasets

    • Use multivariate analysis when dealing with multiple potential substrates or conditions

  • Dealing with Uncertainty:

    • Clearly report confidence intervals and effect sizes, not just p-values

    • Consider using more stringent significance thresholds when conducting multiple tests

    • Be transparent about limitations and potential sources of error

What emerging technologies could accelerate functional characterization of proteins like MJ0704?

Several cutting-edge approaches show promise:

  • Advanced Structural Techniques:

    • Cryo-electron microscopy (cryo-EM) for determining protein structures without crystallization

    • Integrative structural biology approaches combining multiple experimental datasets

    • Time-resolved structural methods to capture conformational changes during function

  • High-Throughput Functional Screening:

    • Microfluidic enzyme assay platforms for testing thousands of potential substrates

    • Droplet-based directed evolution to identify conditions that promote activity

    • Activity-based metabolomics to identify substrates without prior hypotheses

  • Systems Biology Integration:

    • Multi-omics approaches combining proteomics, metabolomics, and transcriptomics

    • Genome-wide CRISPR screens in model archaea to identify genetic interactions

    • Computational models integrating diverse datasets to predict protein function

  • In situ Approaches:

    • Development of genetic tools for direct manipulation of M. jannaschii

    • Proximity labeling methods to identify interaction partners in native contexts

    • Advanced imaging techniques to track protein localization and dynamics

How might understanding MJ0704 contribute to broader research on archaeal biology?

The functional characterization of MJ0704 could advance several key areas:

  • Archaeal Membrane Protein Biology:

    • Based on its sequence, MJ0704 appears to have transmembrane regions, suggesting it may be involved in membrane-associated processes

    • Understanding MJ0704 could provide insights into archaeal membrane biology, which differs significantly from bacterial and eukaryotic systems

  • Extremophile Adaptations:

    • As M. jannaschii is a thermophilic methanogen, MJ0704 might be involved in adaptations to extreme environments

    • Characterizing its function could reveal novel mechanisms for protein stability or activity under high-temperature conditions

  • Evolution of Metabolic Pathways:

    • MJ0704 might represent an archaeal-specific enzyme in a conserved metabolic pathway

    • Its characterization could illuminate how core metabolism has evolved across domains of life

  • Methanogenesis Research:

    • If MJ0704 plays a role in methanogenesis or related pathways, its characterization would contribute to understanding this ecologically important process

    • This could have implications for both basic science and applied research on microbial methane production

What methodological lessons from studying model archaeal proteins can be applied to MJ0704?

Important methodological considerations include:

  • Lessons from M. jannaschii RNase P Studies:

    • The recent cryo-EM structure of M. jannaschii RNase P revealed unexpected stoichiometry and oligomeric states

    • This suggests the importance of applying multiple biophysical techniques (like native mass spectrometry) to verify protein complex composition for MJ0704

  • Insights from Isopentenyl Phosphate Kinase Characterization:

    • The characterization of MJ0044 demonstrates how initial function predictions can be incorrect

    • This emphasizes the need for direct enzymatic testing rather than relying solely on sequence similarity

  • Genome Reannotation Approaches:

    • The comprehensive reannotation of M. jannaschii leading to MjCyc demonstrates the value of integrating multiple evidence types

    • Similar integrative approaches should be applied to characterizing MJ0704

  • Comparative Systems Approaches:

    • Lessons from the genetically tractable methanogen Methanococcus maripaludis can inform experimental design

    • Consider how findings in related organisms might guide hypotheses about MJ0704 function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.